SKU: 47598436872

Human Tau, His Tag

Sale price$150.75 Regular price$167.50
Save 10%

Pay in installments of $41.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Tau, His TagProduct Specification Species Human Synonyms Neurofibrillary tangle protein, Paired helical filament tau (PHF tau) Accession P10636 2 Amino Acid Sequence Protein sequence(P10636 2, Met1 Gln186 with C 10*His) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight

Product Specification


Species Human
Synonyms Neurofibrillary tangle protein, Paired helical filament-tau (PHF-tau)
Accession P10636-2
Amino Acid Sequence

Protein sequence(P10636-2, Met1-Gln186 with C-10*His)


MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 20.9kDa Actual: 29kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

The tau proteins (abbreviated from tubulin associated unit) are a group of six highly soluble protein isoforms produced by alternative splicing from the gene MAPT (microtubule-associated protein tau). They have roles primarily in maintaining the stability of microtubules in axons and are abundant in the neurons of the central nervous system (CNS), where the cerebral cortex has the highest abundance. Hyperphosphorylation of the tau protein (tau inclusions, pTau) can result in the self-assembly of tangles of paired helical filaments and straight filaments, which are involved in the pathogenesis of Alzheimer's disease, frontotemporal dementia and other tauopathies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47598436872

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Natalia Arlashina
Waukegan, US
★★★★★ 5
beautiful and high-quality jewelry box
Amazing jewelry box of good quality. color - exactly as in the photo (mine is olive). High-quality interior decoration. Everything as in the seller's photo. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2025
K
Verified Purchase
Katie Roberts
Lake Worth, US
★★★★★ 5
Functional gift.
Used as an engraving project with our laser printer. Worked well, would make a great gift for bridesmaids etc.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 14, 2025
N
Nuby
West Palm Beach, US
★★★★★ 5
Jewelry box that holds a lot.
Color: Pink, Size: 2 Layer
This jewelry box is so sturdy and holds A LOT of jewelry. Not only does it look gorgeous it’s actually functional and does its job ! I highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 22, 2025
D
D.
Carnegie, US
★★★★★ 4
Perfect if you're anything like me
Color: White, Size: 2 Layer
I have about 20 small jewelry boxes sitting in my closet, stacked up high, threatening to topple over any time I reach over them to grab something else. I don't know what's in those boxes, except that it's jewelry I purchased and liked well enough to keep so that I could wear it again. But since all of the pieces are closed up inside, I almost never wear them because I don't want to dig through all 20 boxes to find the 1 thing I want when I'm already almost late to wherever I'm going. If ANY of that sounds anything like you, you need this jewelry box. Is it the most premium thing you've ever seen? No, but does it have a lot of storage space for a pretty compact form factor and hold a ton of stuff? Yes, it totally does. And is the price super reasonable? Yes, it is. And if you kind of squint at it, and look through softer eyes, it doesn't really matter that yes, this is kind of cheaply constructed, and the dividers do move around a little bit because they're not anchored to the sides of the trays. I was able to consolidate all of those jewelry boxes down into this one box, and I no longer need to hold my breath when I try to grab something over the top of the pile because I was able to throw. them. all. out! The satisfaction of purging my own personal leaning tower of Pisa was worth the price alone. But onto the nitty gritty details: yes, the see-through part is acrylic and not glass. I'm okay with that because I don't need more breakable things sitting in my closet. Yes, the dividers aren't super stable. I'm okay with that because they work well enough and keep each piece where it belongs. Yes, it's pleather (aka "vegan leather"). I'm okay with that because I don't need cow hide to hold my jewelry to make it feel more precious, especially because most of my jewelry is pretty inexpensive stuff anyways. I don't notice any glaring cosmetic defects when looking at it, aside from the one very squiggly scratch in my acrylic top that doesn't bother me too much, but since it does mean that quality control may be a bit lacking, this gets a very solid 4 stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 5, 2025
J
Jocelyn Turner
Belleville, US
★★★★★ 5
Elegant Jewelry Box
Color: Pink, Size: 2 Layer, Color: Pink, Size: 2 Layer
Very stylish and elegant jewelry box suitable for your jewelry needs. I needed something for my extensive jewelry collection. I use this for my everyday jewelry, and it works perfectly. I chose the two-tier jewelry box, and I love how sturdy it is. You can put a lot in the box without it being overcrowded. The blush color gives it a soft look, but also the compartments on the inside are soft as well. It is of good quality and a value for what you get.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 2, 2025

recommand products