SKU: 47851564559

LTBR/TNFRSF3 His tag Protein, Human

Sale price$212.40 Regular price$236.00
Save 10%

Pay in installments of $59.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LTBR/TNFRSF3 His tag Protein, HumanProduct Specification Species Human Antigen LTBR TNFRSF3 Synonyms Lymphotoxin beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2 related protein Accession P36941 Amino Acid Sequence Gln31 Met227, with C terminal 8*His

Product Specification


Species Human
Antigen LTBR/TNFRSF3
Synonyms Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein
Accession P36941
Amino Acid Sequence

Gln31-Met227, with C-terminal 8*His QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 27-36kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Piao W., Xiong Y., Li L., et al. Regulatory T cells condition lymphatic endothelia for enhanced transendothelial migration. Cell Reports. 2020;30(4):1052-1062.e5.
2. Schneider K, Potter KG, and Ware CF (2004). Lymphotoxin and LIGHT signaling pathways and target genes. Immunol. Rev. 202, 49-66.
3. Norris P.S., Ware C.F. Madame Curie Bioscience Database. Landes Bioscience; Austin, TX, USA: 2000-2013.
4. Force W.R., Walter B.N., Hession C., Tizard R., Kozak C.A., Browning J.L., Ware C.F. Mouse lymphotoxin-beta receptor. Molecular genetics, ligand binding, and expression. J. Immunol. 1995; 155:5280-5288.
5. Boehm T., Scheu S., Pfeffer K., Bleul C.C. Thymic medullary epithelial cell differentiation, thymocyte emigration, and the control of autoimmunity require lympho-epithelial cross talk via LTbetaR. J. Exp. Med. 2003; 198:757-769.

Background

LTBR is a type 1 single transmembrane protein and member of the tumor necrosis factor receptor (TNFR) family that plays a critical role in the development of secondary lymphoid organs. The human LTBR gene is located on chromosome 12p13, in the same locus as two other members of the TNFR family—TNFR1 and CD27. The human LTBR gene shares 76% homology at the nucleic acid level with its mouse counterpart, located on chromosome 6. LTBR is widely expressed in blood and LECs, intestinal epithelial cells, dendritic cells (DCs), and lymph node (LN) stromal cells. The protein is conspicuously absent in T cells, B cells, and NK cells. LTBR binds strongly to two different natural ligands in homeostatic conditions, LTα1β2 and LIGHT (TNFSF14). LTBR signaling pathway plays an essential role in lymphatic organogenesis, tissue regeneration, organ development, tumorigenesis, and immune response to pathogen infection. Functionally, the absence of LTBR signaling leads to the retention of mature T cells in the thymic medulla.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47851564559

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Karen Brewer
Louisville, US
★★★★★ 3
Love the idea!
Size: 6 Pieces, Size: 6 Pieces
Love the idea of this product! Arrived 3/25/2026 and started using it the same day. Lab puppies (8 months old) loved it too, until one of the tabs was chewed off 😞 One of the puppies ate something (not this product) last week and was sick & finally threw up the rubber pieces he ate. So they can’t use the toys they love!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
G
Verified Purchase
Gabby
Fort Morgan, US
★★★★★ 5
Get 8 pack for bigger / stronger dogs
Size: 6 Pieces, Size: 6 Pieces
This is the best puzzle toy i have found for my GSD mix. All around high quality product 10/10. Thick, durable rubbery material that holds up against a strong chewer. Individual pieces are big and bulky enough that i don’t have to worry about my bigger dog accidentally (or intentionally) swallowing a piece, so i don’t need to supervise. That being said, if you have a bigger dog or a strong chewer, i HIGHLY recommend getting the 8 pack if you actually want to keep them busy for more than 20 mins consistently. Bigger dogs just have more leverage to tug on the pieces because obviously…they are bigger, so its just easier for them. The more pieces you add and more tangled/thicker you can make it, the less leverage they have and the harder it is for them to get a good grip. I have a german shepherd/pitbull mix (big boi, v smart, v strong) and i initially got the 4 pack which, after the first few times, only took him about 5 mins to get all the pieces apart even with level 5 connections. So I ordered an additional 6 pieces (i have a total of 10 pieces now) so i could make it harder for him and it was totally worth it. Now I use 8 pieces with level 5 connections and vital essentials freeze dried beef liver treats inside for my GSD and it consistently takes him 30+ mins to get the whole thing apart. I have timed this lol. I can rebuild the 8 pieces multiple different ways to make it more or less challenging (but i always opt for as difficult as possible to keep him entertained for as long as possible) I use the other two pieces with a level 1 or 2 connection for my other dog- bordercollie mix who is not a very strong chewer, he mostly just rolls it around/ licks it until it finally opens or i help him. Both of my dogs are obsessed with this. And i love watching them try to figure it out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
C
Verified Purchase
Cassandra DeSpain
Chelsea, US
★★★★★ 5
Awesome Tough Chewer Focus Puzzle
Size: 8 Pieces, Size: 8 Pieces
Our 2 yr old busy Mini Goldendoodle (24lbs) looooves this! The material is super tough, yet malleable; he has chewed away and you can’t even tell. We got the 8 pack, worth it! I load them all up with mostly kibble and a treat or two. It took just a short time for him to figure out how to really get it apart. On 1 it came apart really easy for him. We are mostly on 3s, with 2s. When he gets down to only 2 pieces connected it’s usually a 3 and it takes a little longer to get apart due to less leverage. It is mostly easy to use but the higher the plug end is, the more effort it will also take for YOU to get it together. The numbers are a little hard to see, more so on the yellow over the blue. If you use kibble like me, don’t fill it too full as then it won’t connect fully and be prepared for kibble to fly everywhere when they finally get it off. There are holes in the plug part, if you put something in it like peanut butter, remember to poke the holes out! Eew! Other than that they are fairly easy wash out in the sink! Overall, this has become our go to, extended focus, quiet time, [essentially a] slow feeder!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
J
Verified Purchase
Juno
Battle Creek, US
★★★★★ 5
Great!
Size: 4 Pieces
I have a mini Australian Shepherd (37 lbs) and she loves this! She can get level one but has a tougher time with level 2. I have tried 3 but she gives up so she hasn't gotten further than that lol. She is quite stubborn and gives up easy if she can't figure something out and is totally over it. The quality is great as it is thick and not easy to destroy. My fur baby does love it, she seems to think it is fun for at least an hour so it is worth it in my eyes. There are times I have to do something that takes longer and I just can't play with her so this is perfect for her. It was definitely worth the money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 16, 2025
K
Verified Purchase
Kara Riba
Lexington, US
★★★★★ 5
Durable & fun for aggressive chewers.
Color: Yellow
Holding up very well for our aggressive chewer. Squeaker is still intact & our 70-pound pittie breed often chooses this toy to play with over others. Pittie approved.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2026

recommand products