SKU: 49088965308

Human Plectin, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Plectin, His tagProduct Specification Species Human Synonyms Hemidesmosomal protein 1 (HD1), Plectin 1, PLEC1 Accession Q15149 Amino Acid Sequence Protein sequence (Q15149, Leu86 Val180, with C 10*His) LHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRVGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 12. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Hemidesmosomal protein 1 (HD1), Plectin-1, PLEC1
Accession Q15149
Amino Acid Sequence

Protein sequence (Q15149, Leu86-Val180, with C-10*His) LHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRVGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.4 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Plectin is a giant protein found in nearly all mammalian cells which acts as a link between the three main components of the cytoskeleton: actin microfilaments, microtubules and intermediate filaments. In addition, plectin links the cytoskeleton to junctions found in the plasma membrane that structurally connect different cells. By holding these different networks together, plectin plays an important role in maintaining the mechanical integrity and viscoelastic properties of tissues. Mutations in PLEC have been associated with epidermolysis bullosa simplex with muscular dystrophy. A missense variant of PLEC has been recently proposed as a cause of atrial fibrillation in some populations. Isolated left ventricular non-compaction accompanying epidermolysis bullosa simplex with muscular dystrophy was also noted. Plectin has been proposed as a biomarker for pancreatic cancer. Although normally a cytoplasmic protein, plectin is expressed on the cell membrane in pancreatic ductal adenocarcinoma (PDAC) and can therefore be used to target PDAC cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49088965308

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Peg C.
Boise, US
★★★★★ 4
Cut tight, good quality and price.
Color: Sky Blue, Size: Medium
Well made, the material is soft, and comfortable. It’s tight without being clingy. It didn’t shrink when I dried it on medium. The color is as shown and its not see through but is cut tight. So if you have a little extra weight in your stomach area it will not be flattering. Great price and good quality. I’m 5’6, 138lbs, and wear a 36C. I bought a size medium.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
T
Verified Purchase
Tiffany C. Walls
Belleville, US
★★★★★ 5
Good quality
Color: Deep Red, Size: Medium
LOVE this tank top! Great quality for a good price. Form fitting but not too tight. Love the color (red) and material. Will buy more!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
J
Verified Purchase
Jamie
Cuba, US
★★★★★ 5
True to size & color, modest cut, fitted style
Color: Purple, Size: Small
The cut on these tops are perfect. It's a nice v-neck without being revealing. Thick straps and solid back so your bra doesn't show. Sizing is accurate in my case. 5'6" 130lbs chest 34" waist 26" hips 39" and I ordered the small which is fitted on me. I ordered the lavender purple and a black one and both colors are correct in shade. Soft and stretchy material. I air dry them mostly and only gentle low on the dryer if needed and have not had any shrinking.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
M
Verified Purchase
Michelle Schrecke
Houston, US
★★★★★ 5
Great top for summer!
Color: Navy Blue, Size: Large
I bought one of these. The v-neck and fit of the tank top is amazing! Flattering! I loved it so much I ordered two more. Great summer tank! Washes and dries fabulously as well. I am 5’4” 150lbs, wear a medium or size 8-10. I purchased a large and love the look. It fits well, not too tight but hugs the body. Not oversized.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
S
Verified Purchase
ShirleyJ64
Charlottesville, US
★★★★★ 5
Comfortable Fit without over compression
Size: 38B, Color: Gentle Rose
This is a good post surgical bra. I had a lumpectomy and it gave me enough support without being too tight. It is adjustable in the front and the shoulders. Use the size chart to get your best fit. Soft material. Comfortable enough I wore it 24/7 for a couple days. Only downside is handwashing but I will try the delicate cycle on my machine and air dry always.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026

recommand products