Pay in installments of $31.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 16 - Aug 21
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human Plectin, His tagProduct Specification Species Human Synonyms Hemidesmosomal protein 1 (HD1), Plectin 1, PLEC1 Accession Q15149 Amino Acid Sequence Protein sequence (Q15149, Leu86 Val180, with C 10*His) LHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRVGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 12. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical
Product Specification
| Species | Human |
| Synonyms | Hemidesmosomal protein 1 (HD1), Plectin-1, PLEC1 |
| Accession | Q15149 |
| Amino Acid Sequence | Protein sequence (Q15149, Leu86-Val180, with C-10*His) LHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRVGGGGSHHHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | Predicted MW: 12.4 kDa Observed MW: 16 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Plectin is a giant protein found in nearly all mammalian cells which acts as a link between the three main components of the cytoskeleton: actin microfilaments, microtubules and intermediate filaments. In addition, plectin links the cytoskeleton to junctions found in the plasma membrane that structurally connect different cells. By holding these different networks together, plectin plays an important role in maintaining the mechanical integrity and viscoelastic properties of tissues. Mutations in PLEC have been associated with epidermolysis bullosa simplex with muscular dystrophy. A missense variant of PLEC has been recently proposed as a cause of atrial fibrillation in some populations. Isolated left ventricular non-compaction accompanying epidermolysis bullosa simplex with muscular dystrophy was also noted. Plectin has been proposed as a biomarker for pancreatic cancer. Although normally a cytoplasmic protein, plectin is expressed on the cell membrane in pancreatic ductal adenocarcinoma (PDAC) and can therefore be used to target PDAC cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy