SKU: 51405759119

Protein A/G-Cys

Sale price$68.40 Regular price$76.00
Save 10%

Pay in installments of $19.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Protein A/G-CysProduct Specification Synonyms rProtein A G Cys Amino Acid Sequence

Product Specification


Synonyms rProtein A/G-Cys
Amino Acid Sequence

NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDSLEGSGSGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEC

Expression System E.coli
Molecular Weight Approximately 48.0 kDa.
Purity >97% by SDS-PAGE or HPLC.
Conjugation Unconjugated
Tag No Tag
Physical Appearance Liquid
Storage Buffer

20 mM PB, with 400 mM NaCl, pH 7.4.

Reconstitution Before use this product, please read the direction below carefully. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Stock solutions should be apportioned into working aliquots and stored at ≤ -20℃. Further dilutions should be made in appropriate buffered solutions
Stability & Storage

For long term storage, the product should be stored ≤ -20℃.
Please avoid repeated freeze-thaw cycles after reconstitution.
12 months from date of receipt, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution.
3 months, -20 to -70℃ under sterile conditions after reconstitution.

Background

The recombinant Protein A/G-Cys is a genetically engineered protein containing 5 IgG-binding regions of protein A and 2 of protein G. Additionally there is a C-terminal cysteine for Site-Specific Conjugation. Cell wall binding region, cell membrane binding region and albumin binding region have been removed from the recombinant A/G-Cys to ensure the maximum specific IgG binding. The recombinant Protein A/G-cys is ideal for making affinity gel to purification of polyclonal or monoclonal IgG antibodies. Protein A/G binds to various human, mouse and rat IgG subclasses (e.g., human IgG1, IgG2, IgG3, IgG4; mouse IgG2a, IgG2b, IgG3; rat IgG2a, IgG2c) . It also binds to total IgG from cow, goat, sheep, house, rabbit, guinea pig, pig, dog and cat.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 51405759119

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kathryn
Belleville, US
★★★★★ 5
Best chew toy ever!
Size: Small, Color: Textured Ring, Size: Small, Color: Textured Ring
This bone is indestructible. Finally a toy that doesn't get chewed up to pieces.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
L
Verified Purchase
Laurel
Massapequa, US
★★★★★ 5
Heavy duty, excellent quality
Size: Small, Color: Textured Ring, Size: Small, Color: Textured Ring
I trust the Nylabone brand and would not buy a cheap substitute to save a few bucks. This ring is heavy duty. I got it for our 9-week-old puppy and it keeps her interested and entertained with all the little nubs. She uses it more as a toy than something to chew on, tossing it around and mouthing it. It's very hard so I'm not worried about her being able to chew off any little pieces at this point. This satisfies her for now and helps to keep her busy and reigns in some of her puppy energy. Recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2026
N
Verified Purchase
Nunya B
Bozeman, US
★★★★★ 5
Strong
Size: Small, Color: Textured Ring
My French Bulldogs have really strong jaws and are aggressive chewers. These really are sturdy and last a good amount of time. I replace every couple of months and they are one of my dogs favorites and easy for them to hold onto.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
M
Verified Purchase
Marie Phillips
Belleville, US
★★★★★ 4
Durable Chew Toy That Actually Holds Up to Strong Jaws
Size: Large, Color: Bundle
This is a reliable option for a heavy chewer, especially for a large breed with a strong bite. The material feels tough and well-made, and it stands up well to consistent chewing without immediately breaking down like softer toys tend to do. It also gives a bit of dental benefit by helping reduce plaque and tartar buildup during play, which is a nice bonus since brushing isn’t always realistic. The textured surface keeps it interesting enough to hold attention for a while, and it doesn’t splinter or create a mess. Overall, it’s a solid, durable chew toy that works well for strong chewers who tend to destroy most standard toys quickly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
J
Verified Purchase
Justina Stone
Houston, US
★★★★★ 5
Ergonomic good, material so, so
Size: Large, Color: Wishbone
Nice ergonomic, but the plastic come off and dog chew it. I had rather have a stronger material adequate for bigger dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026

recommand products