SKU: 51726117356

Human TSLP Protein, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TSLP Protein, His tagProduct Specification Species Human Synonyms Thymic stromal lymphopoietin Accession Q969D9 Amino Acid Sequence Protein sequence (Q969D9, Try29 Gln159, with C His tag) YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Expression System HEK293 Molecular Weight Predicted MW: 16. 6 kDa Observed MW: 17 25 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated

Product Specification


Species Human
Synonyms Thymic stromal lymphopoietin
Accession Q969D9
Amino Acid Sequence

Protein sequence (Q969D9, Try29-Gln159, with C-His tag) YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Expression System HEK293
Molecular Weight Predicted MW: 16.6 kDa Observed MW: 17-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Thymic stromal lymphopoietin (TSLP) is a cytokine that plays a vital role in the immune system. It was first discovered in the thymus and is mainly produced by stromal cells. TSLP functions as a key mediator in initiating and regulating immune responses. It activates dendritic cells, which then stimulate the differentiation of T helper cells, especially Th2 cells. This leads to the release of various inflammatory cytokines, contributing to the development of allergic and inflammatory diseases. In addition, TSLP is involved in immune responses against certain pathogens. Its dysregulation has been associated with several immune - related disorders, making it an important target for therapeutic interventions in diseases like asthma and atopic dermatitis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 51726117356

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lilyne
Natrona Heights, US
★★★★★ 5
Essential Tees
Number of Items: 5, Color: Navy, Size: XX-Large
Nice quality for some basic, essential tees. The ratio cotton to spandex makes it very comfortable to wear. Great value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
M
Verified Purchase
Meagan
Waukegan, US
★★★★★ 5
Good shirts
100% cotton. Yay! And thicker than the normal 100% cotton shirts I have found. Made well. Could do with better designs and colors but overall am happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
T
Verified Purchase
Tara Willis
Lexington, US
★★★★★ 5
Pleased With Purchase!
Number of Items: 1, Color: Ivory Sharks, Size: Medium
Super cute and soft! True to size!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
J
Verified Purchase
Jason K.
Whiting, US
★★★★★ 5
Very Straightforward and Easy to Use
Reload type: One Time Reload
I have used this several times, and it has always been a smooth and convenient experience. The biggest advantage is how intuitive the process is. Reloading the balance is simple, quick, and easy to understand without unnecessary steps or confusion. It is especially useful for managing spending, setting a shopping budget, or keeping funds ready for future purchases. Instead of entering payment details every time, having balance available makes checkout faster and more convenient. I also appreciate how quickly the funds are applied, allowing immediate use once the reload is completed. This is one of those simple Amazon features that works exactly the way it should. Overall, easy, efficient, and user-friendly. I have been very satisfied with it. Five stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
M
Verified Purchase
Martini81
Whiting, US
★★★★★ 5
Easy and simple: Exact Step-by-Step Guide to Reloading Your Balance
Reload type: One Time Reload
I found reloading my Amazon gift card balance much easier than expected. The process was simple and took about 5 minutes at most. Here are the exact steps to do it: ​Login: In the Amazon app or on Amazon.com, log in to your account. ​ Menu: Tap the 3 lines on the bottom right corner of your screen (next to Rufus, Amazon's AI). ​ Find Category: In the section highlighted "Shop by category," tap on Gifting & Registry (3rd option down in that section) and a drop-down menu will appear. ​ Select Gift Cards: On the drop-down menu, tap Gift Cards (first option). ​ Choose Your Action: "The Gift Card Shop" will appear. There you will have three options: "Redeem a gift card," "View your balance," and "Reload." ​ Start Reload: To add funds, tap Reload. ​ Select Type: Scroll down to "Add funds directly to your Amazon Gift Card balance" and tap which reload type you want (one-time, low balance auto-reload, or scheduled auto-reload). ​ Enter Amount: Choose your reload amount. The default is $25, but you can type in your own amount as well (the minimum amount is $5.00). ​ Finish: Tap the orange "Buy Now" tab. ***I used the Amazon app using the u i OneUI version 8.0 these Amazon app on Android version 16 (Baklava) on a Samsung Galaxy S25 Ultra. Others may have a slight variation of the menu setup on the Amazon app.***
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026

recommand products