SKU: 5258748989

Human AAT, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human AAT, His tagProduct Specification Species Human Synonyms Alpha 1 protease inhibitor, Alpha 1 antiproteinase, Serpin A1, AAT, PI Accession P01009 Amino Acid Sequence Protein sequence (P01009, Glu25 Lys418, with C 10*His)

Product Specification


Species Human
Synonyms Alpha-1 protease inhibitor, Alpha-1-antiproteinase, Serpin A1, AAT, PI
Accession P01009
Amino Acid Sequence

Protein sequence (P01009, Glu25-Lys418, with C-10*His) EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 46.0 kDa Observed MW: 55-70 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Alpha-1 antitrypsin or α1-antitrypsin (A1AT, α1AT, A1A, or AAT) is a protein belonging to the serpin superfamily. As a type of enzyme inhibitor, it protects tissues from enzymes of inflammatory cells, especially neutrophil elastase, and has a reference range in blood of 0.9–2.3 g/L, but the concentration can rise manyfold upon acute inflammation. When the blood contains inadequate amounts of A1AT or functionally defective A1AT (such as in alpha-1 antitrypsin deficiency), neutrophil elastase is excessively free to break down elastin, degrading the elasticity of the lungs, which results in respiratory complications. A1PI also acts to induce locomotion of lymphocytes through tissue including immature T cells through the thymus where immature T cells mature to become immunocompetent T cells that are released into tissue to elevate immune responsiveness.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 5258748989

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gary
Chelsea, US
★★★★★ 4
Great, soft, high-quality pillows, but too thick for me
Size: Standard (Pack of 2), Style: Soft, Configuration: Pillow
This will be a brief review of my pillow journey. I tried a few of the most popular pillows, like MyPillow, Amazon Basics, bamboo/shredded foam, memory pillows, but my most common complaint about them were that they were all just too high and firm for me. I am a restless sleeper and alternate between back, side, and stomach sleeping, and I strongly preferred the stomach sleeper/flat pillows with a polyester fiber/down alternative filling. Here's a ranking of my 4 top pillows: Eversnug Adjustable Layer Pillows - (#1) These were THE pillow for me. I had never heard of these pillows or the company, but I really like being able to adjust my pillow. These pillows came with 2 small, 2 medium, and 2 large pillows and 2 twin zippable pillow pouches. All of them were polyester fiber filled and somewhat flat and soft, but not lumpy. The pillows may not come the exact same sizes, but they are close enough for me. These are the pillows I ultimately decided to stick with, despite being slightly more expensive than the others at $50 for a set of 2 pillows. Nappler Bamboo Shredded Memory Foam Pillow - (#2) Before I found the Eversnug pillows, I was trying the adjustable bamboo shredded memory foam ones. These were my go-to whenever I was testing pillows I didn't like very much. The only downside to these pillows is that if you don't add enough filling, you could feel the edges of the shredded foam. Also, the "bamboo" cover was way too warm and the inner zipper would get too easily caught. Amazon Basics Down Alternative Pillow - (#3) I don't think I've ever been disappointed by an Amazon Basics product yet. These pillows were soft, amazing pillows, but they were 1-2 inches too thick/firm for me. MyPillow - (#4) Despite all the hype around these, they were too lumpy and 1 inch too thick for me. Like I said previously, I ended up going with the Eversnug Adjustable pillows, which I absolutely adore. A tiny bonus is that you can take the pillows you don't use and rest them on your sides or between your knees for some extra cushioning.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 12, 2023
Y
Verified Purchase
Yi Xuan
West Palm Beach, US
★★★★★ 5
Good price and pretty comfortable
Size: Standard (Pack of 2), Style: Soft, Configuration: Pillow
These down alternative pillows are incredibly soft and comfortable, especially for stomach and back sleepers. The soft density gives just the right amount of support without feeling too firm or too flat. I’ve been sleeping much better since switching to these pillows, and they stay fluffy throughout the night. I also love that they’re hypoallergenic, so there’s no irritation or overheating while sleeping. The standard size fits perfectly in my pillowcases, and the white color looks clean and fresh. Getting a 2-pack at this quality is a great value. Highly recommend for anyone looking for cozy, hotel-style pillows at an affordable price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
M
Verified Purchase
Michelle H
Belleville, US
★★★★★ 5
Comfortable Pillows
Size: Standard (Pack of 2), Style: Soft, Configuration: Pillow
These pillows have a nice soft feel and are so comfortable. They’re supportive without being too firm, so my neck feels comfortable throughout the night. They’re lightweight, fluffy, and easy to adjust for different sleeping positions. The material feels smooth and well-made, and the pillows hold their shape better than I expected for the price. They use some alternative fill instead of real feathers which is good for people with allergies.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
C
Verified Purchase
Cassie
Fort Morgan, US
★★★★★ 3
Mid range quality
Size: Standard (Pack of 2), Style: Soft, Configuration: Pillow
They work for kids who aren’t picky. Size fit twin bedding well. Look nice and clean. Quality is mediocre. It wasn’t filled very much even after giving time for it to breathe and fluff. Kind of lumpy and lopsided.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2026
V
Verified Purchase
Veronica Byrne
Chelsea, US
★★★★★ 5
Great pillows!
Size: Standard (Pack of 2), Style: Soft, Configuration: Pillow
I bought these to exchange some old pillows on my son's bed and let me tell you.. they are so soft he fell asleep almost instantly! They keep him nice and cool during the night, they have kept their shape so far and they support your neck perfectly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026

recommand products