SKU: 53267284199

Rat GH Protein, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat GH Protein, His tagProduct Specification Species Rat Synonyms Somatotropin, Growth hormone, Gh1, Gh Accession P01244 Amino Acid Sequence Protein sequence (P01244, Phe27 Phe216, with C His tag) FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF Expression System HEK293 Molecular Weight Predicted MW: 23. 5 kDa Observed MW: 23. 5 kDa

Product Specification


Species Rat
Synonyms Somatotropin, Growth hormone, Gh1, Gh
Accession P01244
Amino Acid Sequence

Protein sequence (P01244, Phe27-Phe216, with C-His tag) FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF

Expression System HEK293
Molecular Weight

Predicted MW: 23.5 kDa Observed MW: 23.5 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.05M Tris-HCl, pH9.5.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Growth hormone (GH) is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration in humans and other animals. GH also stimulates production of insulin-like growth factor 1 (IGF-1) and increases the concentration of glucose and free fatty acids. It is a type of mitogen which is specific only to the receptors on certain types of cells. GH is a single-chain polypeptide that is synthesized, stored and secreted by somatotropic cells within the lateral wings of the anterior pituitary gland.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53267284199

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
M. Durkin
Lowell, US
★★★★★ 5
A Game-Changer for Perfect Grilling!
Size: 2 Probes
I've been using the Typhur Sync WiFi Wireless Meat Thermometer for a few months now, and it's hands down one of the best kitchen gadgets I've invested in. This thing is incredibly reliable, accurate, and convenient, making it a must-have for anyone who loves cooking meats to perfection without constant babysitting. Whether I'm smoking brisket low and slow or grilling steaks for a quick dinner, it delivers spot-on temperature readings every time, helping me avoid overcooking or undercooking disasters. I give it a solid 5 stars! One of the cool features is that it comes with two probes, clearly labeled with numbers 1 and 2. Just a heads up—you have to start with probe 1 inserted first for the system to recognize and sync properly; it's a minor quirk but easy to remember once you get the hang of it. The probes themselves and base are battery-operated and include USB-C rechargeable batteries, which is super handy—no more hunting for disposable ones. The probes charge automatically when inserted into the base. Charging them is straightforward, and they hold up well during long cooks. The real standout is the companion phone app, which elevates the whole experience. The wireless base unit connects to the probes via Bluetooth, but it can't be too far away from them, or they'll lose connectivity (I'd say keep it within 20-30 feet outdoors, depending on obstacles). That's where the app shines—it links to the base over WiFi, allowing you to monitor everything from your phone no matter how far a2ay you are, as long as the base is connected to the internet. I've checked on my roasts from the grocery store or even while running errands, getting real-time alerts for target temps or when it's time to rest the meat. It's freed me up to multitask without worrying. One small downside is that the base takes a long time to charge fully—sometimes a few hours—and it does drain slowly even when not in use, probably due to some standby power draw. I've gotten into the habit of plugging it in regularly, even between uses, to keep it ready to go. It's not a deal-breaker, but worth noting for anyone who might forget. Overall, for the price and performance, the Typhur Sync is worth every penny. It's made my BBQ sessions stress-free and consistently delicious. If you're serious about meat thermometry, grab this—you won't regret it! ⭐⭐⭐⭐⭐
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2026
B
Verified Purchase
Brian Ripperda
Lowell, US
★★★★★ 5
Amazing product
Size: 2 Probes, Size: 2 Probes
This is not a sponsored review: I have tried multiple wireless thermometers for the last few months. I smoke meat every week and knowing the temperature of the meat is extremely important. Having WiFi for them is a game changer. I never had any disconnects and the temperature of the meat was just spot on. I made a pork loin for the first time with it. It told me the ambient temperature and I could see when the projected cook was done. It was the juiciest pork loin I have done. The display was easy to tell and read without having to pull out my phone. The app was easy to read as well. The professional app setting was amazing to see the differences between the 6 sensors all the way down to tenths of a degree. I also got the instaprobe as well. This thing is so fast to read the temperature. It reads an accurate temperature in less than a second. The company is a small upcoming company based in the United States which was a plus for sure. They maybe new to the game but they will definitely make a splash coming soon. It maybe a little more expensive than other wireless probes but it is definitely worth the money. Update after using for a while. I have had no issues at all with the product. The WiFi is amazing and almost never disconnects. The batteries are able to last through the 18-20 hour smoke without charging again. The temps are spot on. After using the Typhur Sync, the meat I have made have came out so much juicier and not dried out at all. The time to put the meat sensor is spot on. I could not recommend this company and its products enough.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2024
D
Verified Purchase
Darryl Richman
Cuba, US
★★★★★ 5
Easy to use by itself or with the App
Size: 2 Probes
==Update 4/5/25 ===================== Last summer Typhur ran a sale for the Sync Quad, so I bought that and gifted the Sync to a friend. (It's still going strong.) The Quad has the same features, but with four probes, which are a bit thinner than the original Sync. I really like that the probes can go in the dishwasher, and the base unit is cleverly designed to display the probes while charging them (which is quick). The device and app both get regular updates. A few months ago the device got the ability to control the volume of the alarms it makes, and recently the app added a feature to allow notes to be added to recorded cooks, for example. ==Original review from 1/20/24 ===================== I've had the Sync for a month and a half now and am super pleased with it. It replaces an Inkbird remote thermometer with wired probes, which had been my go to for several years, but it didn't like being outside in the rain for a long cook. Because the Typhur Sync has wireless probes, I can leave the base in my kitchen out of the weather (even though they claim that the base is waterproof, too.) The cook time prediction is pretty close and allows me to get my sides prepared so everything comes to the table at the same time. The remote connection to my home wifi is strong and never fails. The App on my Android phone is fast to connect and easy to use. It has a "pro" mode that lets you see what each individual temperature sensor is reading, so if you're smoking a big prime rib like I did over Xmas, you can actually see how done it is from the outside in. Because the probes are wireless, you can insert them while inside where the light is good before going out to the grill in the dark. I've used it in my oven too, and it works just as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2024
M
Verified Purchase
Matt Brown
Lexington, US
★★★★★ 4
Accurate and Durable – A Game-Changer for Long Cooks!
Size: 2 Probes
After a lot of research, I decided to invest in this wireless meat thermometer, and I’m really glad I did. My first cook was a brisket, and it helped me keep an eye on the temperature with ease. The durability of these thermometers is impressive – they feel solid and built to last, even with regular use around the heat and elements of a smoker. In terms of accuracy, they’re spot on. The temperature readings have been reliable, which is essential for any serious BBQ enthusiast. These thermometers take the guesswork out of smoking, and they really do work well. The only downside I’ve noticed is occasional connectivity issues. A few times, the connection dropped and it stopped reading, which I’m still troubleshooting. I’m not sure if it’s due to the distance, as the reader is usually inside the house, or if there’s another factor at play. However, I learned that for long smokes, it’s smart to alternate between the two thermometers to keep them charged and ready for the duration. Overall, these thermometers have been top tier, making smoking and grilling much easier and more precise. If you’re willing to keep an eye on the connection, this is an excellent addition to any BBQ setup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2024
J
Verified Purchase
Jason Lee
Charlottesville, US
★★★★★ 5
A must-have high-tech gear for cooking
Size: 2 Probes, Size: 2 Probes
I've been looking at wireless thermometers for while but was unsure about which brand to choose. Then I saw someone on YouTube use the Sync to cook a Christmas turkey and decided to give it a shot. The youtuber didn't just cook the entire turkey as a whole. Instead he cut it into different parts, and cooked them simultaneously at two different durations for optimal results. This was ingenious as dual probes can be extremely helpful for certain foods that require different doneness, and this thermometer monitors both the internal temperature of the food and the ambient temperature. Fast forward two weeks in, and I'm in love with this thermometer. Even though I have an instant food thermometer, I still find myself using the Sync more because you can leave the probe in to get readings instead of having to manually stick the probes in like you would with a traditional food thermometer. As an experienced chef, even though most foods look cooked on the outside, you can never really judge their internal doneness without a thermometer. 1. Highly accurate: Each probe has 5 sensors for multi-zone temperature readings ensuring the lowest point of the internal temperature is displayed with accuracy down to the decimal. I cowitnessed the readings with a high-end instant-read thermometer, and all the readings were consistent with each other. It also comes with an external ambient temperature sensor which is important because, ambient temps may vary in different parts of the oven/smoker/grill. I cowitnessed the ambients temps as well and they were also consistent. 2. Easy to connect: It can easily connect to my phone via wifi or Bluetooth. Once set up, it's super easy to use every time. 3. Stable connection: The wifi or Bluetooth connection is very stable. I've used Sync in a smoker for several cooks now, and even when it was wrapped in foil with a the lid of the smoker on, it never lost connection. There were no complex syncing issues or signal losses. 4. You can monitor the cooking progress from anywhere in your home where you can take your phone or tablet. You don't have to stay in the kitchen. 5. You can set preferences for various alerts via the app. 6. The built-in cooking time estimator is great when you're in charge of larger meals or just want to know when to lower the heat. The app will tell you when the food is done and allow a rest period for the temperature to rise. For example, if you want a medium steak and set the temperature to 135℉, the app will tell you the steak is done when it reaches 130℉ and to allow a 3-5 minute rest period for the temperature to rise to 135℉. This means you can cook proteins perfectly every time. 7. It has a large base screen that's easy to read. 8. Charging is very convenient. Just plug in the charging cable to charge the base, and stick the probes into the base to charge the probes. 9. You can select a preset in the app modify it according to your preferences. 10. Customer service. Initially, when my Sync was not charging, I contacted customer service. To my surprise, they responded quickly and offered to replace the device for free if it was defective. I was very impressed with their quick response and friendly attitude. 11. The 3-year warranty is a nice bonus. Hopefully this review has been helpful. I'll update this review if my views change or I find more ways to use it. If you're concerned about the price being higher than entry-level products, then you probably haven't taken the time to read this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2024

recommand products