SKU: 5499314477

Epididymis Protein 4(HE4) His Tag Protein, Human

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Epididymis Protein 4(HE4) His Tag Protein, HumanProduct Specification Species Human Synonyms Epididymis 4(HE4); WAP Four Disulfide Core Domain Protein 2, Epididymal Secretory Protein E4, Major Epididymis Specific Protein E4, Putative Protease Inhibitor WAP5, WFDC2, HE4, WAP5 Accession Q14508 Amino Acid Sequence EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFHHHHHH Expression System HEK293 Molecular Weight major bands at 19 kDa and 22 26 kDa

Product Specification


Species Human
Synonyms Epididymis 4(HE4);WAP Four-Disulfide Core Domain Protein 2, Epididymal Secretory Protein E4, Major Epididymis-Specific Protein E4, Putative Protease Inhibitor WAP5, WFDC2, HE4, WAP5
Accession Q14508
Amino Acid Sequence EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFHHHHHH
Expression System HEK293
Molecular Weight major bands at 19 kDa and 22-26 kDa respectively which are due to post-translational modifications.
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Human epididymal protein 4 (HE4) belongs to the whey acidic 4-disulfide center (WFDC) protein family and has the characteristics of suspected trypsin inhibitors. Mature human HE4 contains 94 amino acids (aa) and consists of two core structures: a natural N-terminal glycosylated protein of about 25KDa and two core regions of whey acidic protein (WAP, which consists of four disulfide core regions and eight cysteine residues). WFDC2 / HE4 can undergo a series of complex alternative splicing events and may produce five different protein subtypes containing WAP domains. It is expressed in many normal tissues, including the male reproductive system, respiratory region and nasopharynx. It is highly expressed in ovarian, colon, breast, lung, kidney and other tumor cell lines.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 5499314477

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Phoenix, US
★★★★★ 5
Matt Groening
Format: Paperback
i want matts autograph
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 1999
D
Verified Purchase
david shen
Fort Morgan, US
★★★★★ 1
Terrible condition!!! not readable. what a shame!
Format: Paperback
Terrible condition!!! not readable. what a shame!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2022
M
Mike Reed
Bozeman, US
★★★★★ 3
Krustonia
Format: Paperback
This was an okay book, with nothing exceptional. Starting the book off with "Krustonia" was a big mistake, as it's easily the worst Simpsons comic ever. Once you start reading it, it gets boring, so take my advice, read everything else first, then come back to this one, since I lost enthusiasm after struggling to complete Krustonia for several days. That said, Homer's wresting days are really funny, the Smithers clones are strange, but somehow very entertaining. (Mr. Burns better watch out :) and Homer as Radioactive Man was great, especially to see Leon "Michael Jackson" Komposki back. I also liked the mini-Ned Flanders mystery, and the guide to comic book conventions. If it weren't for Krustonia, this book would be the perfect buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 30, 2000
C
Verified Purchase
cybereality
Houston, US
★★★★★ 5
Perfect For Game Developers w/ Some Experience Wishing To Learn Unreal Fast
Format: Kindle
Rachel Cordone’s Unreal Engine 4 Game Development Quick Start Guide is the perfect book for people with some programming chops, or users of other engines (like Unity), that want to get up to speed quickly with Unreal. I really liked how the author does not waste time explaining basic things (like what functions or variables are) and jumps to the practical steps for getting things working. Unreal experience is not required at all, though you should have some foundation of how programming works to get the most out of the text. Most of the book is using Blueprints, the built-in visual scripting language of UE4. I’m a huge fan of Blueprints, and visual scripting in general, and you can accomplish many things, even a whole game, without touching C++. However, Rachel does show how to use C++ and interface with Blueprints code (very handy). Within the book, the author explains each step along the way to accomplish various things, along with screenshots of the Blueprints, making everything easy to follow. Some of the topics covered include: the basics of navigating the editor, using variables, functions, events, and creating a Blueprint from scratch. Adding C++ to a Blueprint project. Creating menus and HUDs with UMG, animation, scripting AI, multiplayer, and optimization. Definitely not an exhaustive list, but a good range of information to get a feel for how powerful Unreal is and how to quickly start working with it. So far, I’ve only read maybe a couple other Unreal books, but I think I can say this is the best I’ve seen. While some other books are longer and more in depth, as this one only clocks in at just under 200 pages, I feel like the brevity helps keep things focused. While you’re not creating Grand Theft Auto here, the simple demo built in the book is functional and teaches the basics of how you would make a game in Unreal. This is a case where the title of the book is very apt and honest. This is a “quick start” guide for game developers not familiar with Unreal Engine 4, but maybe that have experience with Unity or some other engine or framework. I think if you are a complete beginner, you might want to read up on basic programming concepts first, though the book is simple enough you could probably just jump in if you really wanted. For people with experience elsewhere, this is perfect to get up to speed with Unreal fast. I can’t recommend this book enough.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 31, 2019
D
Verified Purchase
Dr. Glen V
Fort Morgan, US
★★★★★ 5
Easy to follow and very thorough.
Format: Paperback
I went from start to finish on this book and feel more than comfortable with the basics of this platform. If I can do it, so can journalists.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2022

recommand products