SKU: 93617578833

Myoglobin His Tag Protein, Human

Sale price$360.00 Regular price$400.00
Save 10%

Pay in installments of $100.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Myoglobin His Tag Protein, HumanProduct Specification Species Human Synonyms MB MGC13548 MYG_HUMAN Myoglobin Accession P02144 Amino Acid Sequence MHHHHHHDDDDKGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG Expression System E. coli Molecular Weight 18. 4kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms MB MGC13548 MYG_HUMAN Myoglobin
Accession P02144
Amino Acid Sequence MHHHHHHDDDDKGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Expression System E.coli
Molecular Weight 18.4kDa(Reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris,100mM NaCl, pH8.0
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Myoglobin (myoglobin,Mb) is a binding protein composed of a peptide chain and a heme auxiliary group. It is mainly distributed in myocardium and skeletal muscle. The increase of serum Mb level results from the release of skeletal muscle and / or cardiomyocyte injury (dissolution / necrosis) to blood circulation. Serum Mb < 70ng/ml, and its level varies with age, sex and race. Mb can be detected in serum in the early stage after myocardial infarction, and the peak time (1-2 hours) is earlier than creatine kinase (creatine kinase,CK). Mb is easy to be excreted from urine because of its small molecular weight. After reperfusion therapy, the level of serum Mb increases rapidly, so it has been used as a useful index to evaluate the success of reperfusion therapy or the size of myocardial infarction, but because the half-life of Mb is short (15 minutes), the level of serum Mb does not increase 6-12 hours after the attack of chest pain, which is helpful to rule out acute myocardial infarction. At the same time, because the duration of the increase of Mb level is very short (< 24 hours), the determination of Mb is helpful to observe whether there is re-infarction or infarction expansion in the course of acute myocardial infarction. The frequent increase of Mb level indicates that the original myocardial infarction is still persistent. It should be pointed out that Mb is also a component of skeletal muscle and lacks specificity, so the clinical value of a series of Mb determination after myocardial infarction is limited. For patients with chest discomfort and non-diagnostic electrocardiographic manifestations, acute myocardial infarction can not be diagnosed by Mb alone within the first 4-8 hours of onset, but should be supplemented by more specific examinations, such as CK-MB or cardiac troponin.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93617578833

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
David P. Irvine
Natrona Heights, US
★★★★★ 3
Not Wrinkle Free
Color: Blue, Size: X-Large
I like these shirts because they are comfortable and cool. The microfiber fabric is smooth and breathable. However, I find that they must be ironed while damp for best appearance. They do not dry wrinkle free. Also, small specks of lint from the washer seem to get caught in the microfiber weave.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 25, 2025
A
Verified Purchase
Alisha
Belleville, US
★★★★★ 5
Very nice shirt
Size: 22" Neck 35"-36" Sleeve, Color: Blue Frost
Loved the quality and fit well. A little tighter in the chest than expected, but overall would buy again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
O
Verified Purchase
Ogden Utah
West Palm Beach, US
★★★★★ 5
Great buy!
Size: 20" Neck 35"-36" Sleeve, Color: Blue Frost
Nice fit, speedy shipment.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
G
Verified Purchase
Gabe W.
Charlottesville, US
★★★★★ 4
Great Shirt except for the Cuff Size
Size: 20" Neck 34"-35" Sleeve, Color: White
My only complaint is that when I use the inner cuff buttons to make the cuffs tighter, the cuffs still aren’t small enough (larger than my other shirts of the same size). My wrists are about average, or maybe even a little larger than average. This feature is important for those of us who need a larger neck size but a shorter sleeve. They don’t make a 20 inch collar with a 32/33 sleeve (for some reason)… unless you order a custom shirt for several times as much money… so I have to buy a shirt with sleeves that are too long. That works fine as long as I can use the second cuff button to make the cuffs tighter, so that the sleeves don’t ride down onto my hand when I’m wearing my suit. It’s annoying to have to take a new shirt to a tailor to have the cuff buttons relocated.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2025
A
Verified Purchase
Anonymous
Dallas, US
★★★★★ 5
Comfortable Dress Shirt with a Professional Look
Size: 22" Neck 34"-35" Sleeve, Color: White
This dress shirt has a clean, polished appearance while still being comfortable enough to wear for long periods. The stretch fabric and flex collar make a noticeable difference in comfort, especially around the neck and shoulders. The fit was true to size, and the material feels lightweight without looking thin. Overall, a solid option for work, formal events, or anyone wanting a classic white dress shirt with a little extra flexibility.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026

recommand products