SKU: 55328989763

FABP1 His Tag Protein, Human

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP1 His Tag Protein, HumanProduct Specification Species Human Synonyms LFABP Accession P07148 Amino Acid Sequence Met1 Ile127, with N terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAG E& RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage

Product Specification


Species Human
Synonyms LFABP
Accession P07148
Amino Acid Sequence Met1-Ile127, with N-terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity >95% by SDS-PAG E& RP-HPLC
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

FABP1 (LFABP) has been initially characterised in the liver (thus its name) but is also expressed in small intestine (duodenum and jejunum). FABP1 appears to be the most promiscuous FABP as it was reported to bind a variety of small molecules in addition to fatty acids including bile acids, lysophosphatidic acid, prostaglandins, fatty acyl-CoA, bilirubin and heme. FABP1 is a PPARα target gene. While some studies suggested that FABP1 might be involved in the delivery of ligands for PPARα activation in the nucleus, FABP1-deficient mice showed normal regulation of PPARα target genes regulation. FABP1 was reported to enhance apoB-lipoprotein secretion, which would suggest involvement of this protein in the delivery of fatty acids to the ER for esterification into lipoprotein-destined TG. Hepatic fatty acid oxidation is also diminished in fasted FABP1 knockout mice, which implies deficient transport of fatty acids to the oxidative pathway. Interestingly, no accumulation of intracellular TG accompanied attenuation of fatty acid oxidation even when the mice were challenged with a high-fat diet.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 55328989763

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Krystal Baker
Whiting, US
★★★★★ 5
Great sun block
Love this! Bought for vacation used every day, no sun burn and nice soft skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
S
Squiddy
Lowell, US
★★★★★ 3
Adds a nice glow but stays oily and don’t trust the SPF!
Color: Rose, Color: Rose
Edit: taking this down to 3 stars after I finally got the chance to wear it in the sun for several hours and test the SPF. I went to an outdoor event and wore just the glow oil for 4 hours and got some pretty good sunburns on my face and shoulders (see last photo)! The only reason I didn’t take the stars lower is that they advertise it as a glow glitter oil before spf and that part is true. I’d also note that after an hour in the sun my sweat started to bead up because of the oil- I’d normally sweat yes but in a sheen that isn’t super noticeable vs big drops all over that made me look like I had a fever or something! I also never felt like the oily feeling absorbed into my skin. So I 100% won’t be trusting this for SPF in the future and with the oily feeling I don’t think I’d even wear it for just the shimmer look. I’ll admit I was a little skeptical about the spf of this oil, but I looked at all the ingredients and GPT says it’s good stuff lol! So far I’ve only worn it for maybe an hour so hard to say for sure how effective it is but the ingredients are solid. The oil gives a nice gleam and subtle shimmer to your skin, not too glittery. It is oil so it doesn’t really rub in, I don’t know if I’d wear it with any super nice clothes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
A
Verified Purchase
Allyison Kissel
Houston, US
★★★★★ 5
Great alternative to the high end brand.
This product was delightful! Glides on beautifully, and provides great sun protection. I am fairly light complexed and this did its job keeping me from getting burned. It also leaves a beautiful glow on your skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 27, 2025
E
Verified Purchase
euridice peralta
Carnegie, US
★★★★★ 5
Lovely
First time using it and I will used for the rest of my life specially in summer. My skin looks like tv model
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 1, 2025
P
Pickle for a nickle
Houston, US
★★★★★ 1
Pure grease! Irritated skin
Xiuxixu Body Glow Oil Broad Spectrum SPF 45, sunscreen body oil lightweight glowing lotion moisturizing coconut oils waterproof non-sticky texture easy absorb, #02 Rose Gold 3.38 fl oz. Made in China. This arrived like-new, in sealed, nondescript, pink packaging. I guess I should’ve known better from the brand name…but the unique rose gold color lured me in. It’s very pretty in the bottle too. But the shimmer totally disappears when rubbed into the skin. I was shocked I couldn’t seen a shine in several different lightings(other than looking very oily). It absolutely REEKS of sunscreen, too, and is VERY greasy. Whatever you touch— it WILL transfer! Also, the ingredients list is really sketchy. Lots of long chemicals I can’t pronounce. Even though I immediately wiped this off, it ended up making my skin breakout/turn red and itchy for a day. No, I would not recommend this product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2025

recommand products