SKU: 56044618414

LILRA3 His Tag Protein, Human

Sale price$306.00 Regular price$340.00
Save 10%

Pay in installments of $85.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRA3 His Tag Protein, HumanProduct Specification Species Human Synonyms Leukocyte immunoglobulin like receptor subfamily A member 3 Accession Q8N6C8 Amino Acid Sequence Gly24 Glu439, with C terminal 8*His

Product Specification


Species Human
Synonyms Leukocyte immunoglobulin-like receptor subfamily A member 3
Accession Q8N6C8
Amino Acid Sequence Gly24-Glu439, with C-terminal 8*His GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 68-75kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3) is also known as CD85 antigen-like family member E (CD85e), immunoglobulin-like transcript 6 (ILT-6) belongs to a family of leucocyte receptors. LILRA3 lacks a transmembrane domain and it is highly homologous to other LILR genes, and can bind human leukocyte antigen (HLA) class I. The biologic role of the LILRA3 molecule and the nature of its ligand are not known. LILRA3 can bind with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes. It can be detected in B-cells, natural killer (NK) cells, peripheral blood monocytes and lung. LILRA3 transcripts are markedly upregulated in neutrophils from patients with antiphospholipid syndrome (APS). Some polymorphisms of the LILR genes are reported to be associated with susceptibility to diseases such as rheumatoid arthritis and multiple sclerosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 56044618414

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
cami
Whiting, US
★★★★★ 5
Love it!
Size: 8.45 Fl Oz (Pack of 1)
The skin absors it completly. Great for oily skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
C
Verified Purchase
cass
Natrona Heights, US
★★★★★ 5
So glad I finally tried this totally worth it!
Size: 8.45 Fl Oz (Pack of 1), Size: 8.45 Fl Oz (Pack of 1)
I love Korean skincare and have been wanting to try Anua for a while, but I always found it a little on the pricier side. I was placing a Black Friday order and snagged this toner for $15, and I’m so glad I did! I originally wanted to try their azelaic acid serum, but since I already use a lot of serums, seeing it in toner form felt perfect — and it really is. I’ve been using this morning and night, and my skin already looks brighter. I have a lot of acne scarring, and even in the short time I’ve been using this, I’ve noticed visible improvement. It’s super gentle, not harsh at all, and has a light, pleasant scent (which doesn’t seem like added fragrance). My skin is extremely acne-prone, and this hasn’t broken me out whatsoever. If anything, it feels calming. So far I’ve truly enjoyed this product, and I definitely recommend it if you’re looking for something soothing that actually helps with texture, spots, and overall clarity!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025
T
Verified Purchase
They are so cute and comfortable
Alexandria, US
★★★★★ 5
Great toner
Size: 8.45 Fl Oz (Pack of 1)
I love the toner , I will continue to purchase .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
A
Verified Purchase
Amazon Customer
Massapequa, US
★★★★★ 4
4 Stars
Size: 8.45 Fl Oz (Pack of 1)
It works really well. Not too strong in its ingredients and no smell. My skin loves it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
S
Verified Purchase
susana fernandez
Whiting, US
★★★★★ 5
Helps clear up dark spots
Size: 8.45 Fl Oz (Pack of 1)
I have been using this product for a few weeks now and can say it's cleared up of few spots on my face. Definitely worth buying this product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026

recommand products