SKU: 56511678995

MERTK His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MERTK His Tag Protein, MouseProduct Specification Species Mouse Synonyms MER, STK Kinase, Tyro12, C Eyk, C Mer, RP38 Accession Q60805 Amino Acid Sequence Gly19 Met497, with C terminal 8*His

Product Specification


Species Mouse
Synonyms MER, STK Kinase, Tyro12, C-Eyk, C-Mer, RP38
Accession Q60805
Amino Acid Sequence

Gly19-Met497, with C-terminal 8*His GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 80-110kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Graham, D.K. et al. (1994) Cell Growth Differ. 5:647.

2.Graham, D.K. et al. (2006) Clin. Cancer Res. 12:2662.

Background

Tyrosine-protein Kinase Mer, also known as c-Mer and MerTK, is a member of the receptor tyrosine kinase subfamily TAM (Tyro3, Axl, and Mer). Similar to Axl and Tyro3, the extracelluar domain of Mer contains two Ig-like motifs and two fibronectin type III motifs. Mer is not expressed in normal B- and T-cells but expressed in neoplastic B- and T-cell lines . It is also show higher expression in immunosuppressive M2‑like macrophages. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.Mer is known to bind Gas6, Protein S, Tubby, Tubby-like protein 1 (Tulp1), and Galectin-3. Upon binding ligands via the Ig-like motif, Mer is dimerized to trans-autophosphorylate the kinase domain to induce downstream signaling. It has been shown that Mer signaling in macrophages induces M2 polarization, which promote tumor growth, metastasis and evasion of anti-tumor immunity in tumor microenviroment. Inhibition of Mer, especially on leukocytes and macrophages, is an effective anti-cancer therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 56511678995

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Ditto503
Pawtucket, US
★★★★★ 5
Protects your mattress from toddler spills!
Size: Full, Size: Full
Writing this after my toddler spilled a ton of water on my bed (a new mattress). I didn't realize what she had done for about 1 minute. By the time I got her off the bed, pulled the sheet off and pulled the mattress protector off, the mattress was still dry! I felt the bottom plastic part of the mattress protector and could feel the coolness of the water, but not dampness. This thing works! Note, I don't know how it would perform if I had left it for a really long time. The protector is also very soft on top, not noisy, and easy to stretch over the mattress. You can kind of see the square shapes of the protector through the sheet, but I personally don't care. It was a great buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
B
Verified Purchase
Bought this for my husband birthday gift he loves
Phoenix, US
★★★★★ 5
Quality
Size: King
Fits perfectly quality of money,comfortably,
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
M
Verified Purchase
Mark Taylor
Lake Worth, US
★★★★★ 5
Great fit deep pockets
Size: Queen
Fits a deep queen mattress really well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
J
Verified Purchase
Jean
Houston, US
★★★★★ 1
Fit
Size: Queen
Would not stay on the bed
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
A
Verified Purchase
Amazon Customer
Battle Creek, US
★★★★★ 5
Good fit
Size: Queen
Covered the mattress well. It was not noisy. Sheets are wee bit oversized and the the cover helps keep the sheets from sliding around. Kids are older so it’s more for the pets. I do recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2026

recommand products