Pay in installments of $57.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 10 - Aug 15
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRB2/CD85d/ILT4 His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Accession BAE87348. 1 Amino Acid Sequence Gly24 Leu448, with C terminal 8*His
Product Specification
| Species | Cynomolgus |
| Accession | BAE87348.1 |
| Amino Acid Sequence | Gly24-Leu448, with C-terminal 8*His GTLPKPMLWAEPGSMISEGSPVTLRCQGSLQVQEYRLYKGKKPASWVRRIQQELVKKGYFAIGFITWEHTGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVSLQCDSQVTFDGFVLCKEGEDEHPQRLNSQSHARGWSWAVFSVVPVSPSRRWSYRCYGYDSHSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCGSDVGYDRFALYKEGERDFLQRPSRQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSSEWSAPSDPLDILISGQIRGTPFLSVQPGPTVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMYKYPKYQAELSMSPVTSAHAGTYRCYGSLSSNPYLLSVPSDPLELVVSGAVDTLGLSQNNSETKTASHSQDYTVENLGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 63-70kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Leukocyte immunoglobulin (Ig)-like receptor B2 (LILRB2) is a member of leukocyte Ig-like receptors (LILRs), also known as CD85D, ILT4, LIR2, and MIR10, contains four extracellular immunoglobulin domains, a transmembrane domain, and three cytoplasmic ITIMs. It is expressed on hematopoietic stem cells, monocytes, macrophages, DCs, neutrophils, basophils, platelets, and activated CD4+T cells, as well as in vitro cultured endothelial cells, mast cell progenitors, and osteoclasts. LILRB2 plays physiological roles in multiple tissues. LILRB2 is involved in immunotolerance in pregnancy and transplantation. HLA-G/LILRB2 interactions promote accumulation and the suppressive activity of MDSCs during human pregnancies. Crosslinking of LILRB2 with Fcγ R in vitro led to inhibition of Fcγ R-mediated signaling in monocytes and serotonin release in basophilic cells. Upregulation of LILRB2 induced the tolerance of DCs. Interaction of LILRB2 with HLA class I molecules is positively associated with viral replication in HIV, suggesting that this interaction leads to a blunted immune response. Upregulation of LILRB2 and LILRB4 in antigen-presenting cells in response to Salmonella infection suggests a role for these receptors in balancing the inflammatory response against bacterial infection. LILRB2 is localized in neutrophil lipid rafts and rapidly moves to the cell surface upon neutrophil stimulation. This upregulated LILRB2 then enhances the inhibitory signals of HLAG on the phagocytic function of neutrophils. Future studies are required to shed light on how neutrophil and immune responses are modulated through LILRB2 interactions with this diverse set of ligands.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy