SKU: 57386578826

CD34 Fc Chimera Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD34 Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen CD34 Synonyms RP11 328D5. 2, CD34 molecule, HPCA1 Accession Q64314 1 Amino Acid Sequence Thr35 Thr287, with C terminal Human IgG Fc

Product Specification


Species Mouse
Antigen CD34
Synonyms RP11-328D5.2, CD34 molecule, HPCA1
Accession Q64314-1
Amino Acid Sequence

Thr35-Thr287, with C-terminal Human IgG Fc TTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 72-95kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Laura E Sidney, Matthew J Branch, Siobhán E Dunphy, Harminder S Dua,and Andrew Hopkinson. Concise Review: Evidence for CD34 as a Common Marker for Diverse Progenitors. Stem Cells. 2014 Jun; 32(6): 1380-1389.Published online 2014 May 23.

Background

CD34 is predominantly regarded as a marker of hematopoietic stem cells (HSC) and hematopoietic progenitor cells. However, CD34 is now also established as a marker of several other nonhematopoietic cell types, including vascular endothelial progenitors and embryonic fibroblasts. Accumulating evidence demonstrates CD34 expression on several other cell types, including multipotent mesenchymal stromal cells (MSC), interstitial dendritic cells, and epithelial progenitors, but there remains limited recognition of the role of CD34-positive (CD34+) cells outside of each individual specialty.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57386578826

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
soultwin5
Phoenix, US
★★★★★ 4
Decent for the price.
Color: Rainy-Rainbow
The color is pretty, the bottle seems to be working well for now. The atomizer pump is so cute and makes me feel super dainty and girly! I love the xtra refill, the funnel and two glitter glues for makeup looks. The glue is good enough to hold the glitter but not too sticky where it leaves a nasty residue. So that’s a plus and it’s easy to wash off. However, the glitter does not adhere or stay in place on dry skin. I’m assuming it’ll be great to spray on the body if you have some type of oil in for it to adhere too but haven’t tried it yet. Will update next weekend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 7, 2026
J
Verified Purchase
Jazmin
Draper, US
★★★★★ 5
10/10
Color: Iridescent-Violet
I love this! It has a lot of glitter and it last a long time! It sprays smoothly and looks so good!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
S
Verified Purchase
Sassyondra
Carnegie, US
★★★★★ 5
Love it.
Color: Rainy-Rainbow
This glitter is gorgeous on. Really easy to apply, sprays evenly and a good amount at once. It wasn’t a nightmare to deal with either clinging to things it fell/rubbed onto which I was pleasantly surprised by. It cleans up very well. A little goes a long way too, so it should last a while. It stayed on my body fairly well throughout the night too. I have really sensitive skin so I was hesitant to even get glitter at all. I tried body glitter 2 years ago but it was a liquid spray kind and I broke out in an intense rash all over. I also have a chronic hive condition so my skin flares up from products due to sensitivity. I did not have ANY issues with this glitter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2025
J
Verified Purchase
Judith G.
San Leandro, US
★★★★★ 5
Absolutely Stunning Glitter with Thoughtful Packaging! | Rainy Rainbow
Color: Rainy-Rainbow, Color: Rainy-Rainbow
This glitter is breathtaking! The sparkles catch the light very beautifully — it has a mesmerizing, holographic shine that’s perfect for adding extra pizzazz to any project. When it arrived, I was pleasantly surprised at how well it was packaged. The box was securely sealed, and everything inside was perfectly intact—minor spills, no mess. A heads up on opening the entire thing: the round container’s Lid is screwed on VERY LOOSELY. Be mindful when you’re unboxing. Screw it back on very tightly. The spray nozzle on this bottle gives such a beautiful, antique perfume vibe—it really elevates the whole experience. It sprays the glitter perfectly, so it’s easy to get a flawless application every time. (Don’t forget to keep the little nozzle cover to protect it!) Honestly, I wouldn’t apply it any other way than with the bottle—it just makes everything so much smoother. 🤷🏻‍♀️ If you happen to go overboard, just grab the closest shirt and wipe off any excess. No point in wasting any of this stuff! :) Oh, & those two little gloss bottles are actually glue, which is perfect for keeping everything right where you need it to be. Here’s a little pro tip: I used the same tape that kept the box sealed to reseal the lid of the round glitter container until I’m ready to use it. Worked like a charm! 😎 It’s a small detail, but it will keep everything neat, and prevent unwanted glitter explosions in the future. If you’re a sparkle lover, you’ll adore this glitter—it’s as pretty in person as it looks online!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 16, 2024
G
Verified Purchase
Gislaine Cavassini
Belleville, US
★★★★★ 5
incredible
Color: #03 Champagne
Simply wonderful! The fragrance is delicate and sophisticated, leaving the skin gently scented all day long. The glitter has an elegant shine and is not exaggerated, perfect for parties or special events. The application is super practical, spreads easily and the fixation is great. I recommend it to those who want a touch of glamour and brightness with an incredible smell!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026

recommand products