SKU: 59783981240

Human Reg4, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Reg4, His tagProduct Specification Species Human Synonyms Gastrointestinal secretory protein, REG like protein, Regenerating islet derived protein IV (Reg IV), GISP, RELP Accession Q9BYZ8 Amino Acid Sequence Protein sequence (Q9BYZ8, Asp23 Pro158, with C 10*His) DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRPGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted

Product Specification


Species Human
Synonyms Gastrointestinal secretory protein, REG-like protein, Regenerating islet-derived protein IV (Reg IV), GISP, RELP
Accession Q9BYZ8
Amino Acid Sequence

Protein sequence (Q9BYZ8, Asp23-Pro158, with C-10*His) DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 17.6 kDa Observed MW: 56-72 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Regenerating islet-derived protein 4 (Reg4) also called Reg IV or RELP (Reg-like protein), is a secreted glycoprotein belonging to the regenerating gene (Reg) family within the calcium (C‑type) dependent lectin superfamily. Reg4 expression is induced by growth factors and promotes phosphorylation and activation of the EGF R. Reg4 is preferentially expressed in the gastrointestinal (GI) tract. Reg4 expression is increased within or near inflammation, dysplasia and metaplasia of the GI epithelium, such as inflammatory bowel disease (Crohn’s disease and ulcerative colitis), colon adenocarcinoma, pancreatic cancer, gastric adenocarcinoma, and is often increased in the plasma in these conditions. It is especially associated with neuroendocrine tumors in the GI, as well as some prostate, parathyroid, skin Merkel cell and lung small-cell carcinomas. Tumor cells expressing Reg4 are generally more mitogenic, metastatic and resistant to apoptosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 59783981240

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Roberta Mayes
Fort Morgan, US
★★★★★ 5
Heavy duty legs for table.
Size: side table leg
Perfect legs for a table I am having made. I have an cottonwood slice. It's heavy and needed something substantial. These are perfect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
R
R. Moheban
Houston, US
★★★★★ 5
Robust pipe & fittings with a beautiful, smooth black finish
Size: side table leg
This set of pipe & fittings for use as low table legs is heavy duty and aesthetically pleasing. Especially when the pieces are handled, the tactile sensation is much nicer than with plumbing steel pipe because this product is beautifully finished smooth. The black pipes are quite smooth as well as the fittings. The pieces are all also pretty robust, though the wall thicknesses are less than in pipe for pressurized water systems. Of course that makes sense as this product does not need to hold fluid pressure. In my view they got the heaviness factor of this product just right; it's not as heavy or robust as black pipe used in natural gas supplies, but still robust and pretty heavy. Assembled, this product is absolutely stiff and unyielding for a solid table that could hold a man's weight easily. The feet utilize a brilliant scheme so that each foot can be independently adjusted for an uneven floor. Thus a level table on an uneven floor is easily accomplished. The feet simply extend the effective leg length by screwing counter-clockwise. To prevent any shifting at the threads adding some pipe compound or teflon tape may be advised. Even masking or duct tape might work as the idea is to just fill any gaps where male threads meet female threads. The four flanges at the tops of the legs provide a wide, solid surface for attaching the table top, with either hidden screws underneath or you could through-bolt a glass table top (provided you have the skill to drill glass!). I think this product would look great with a glass top. Assembly is quick and easy. The hardest part is drilling holes underneath the table top to accept screws. No pipe wrenches are needed as the pieces screw together by hand to an adequate tightness. If any doubt whether they are tightened enough have a strong person with grippy gloves finish. The "X" in the center attaches to the legs with a very clever machine screw system tightened with the included hex wrench. This is presumably because if tightened simply by screwing the fittings, the point of snugness would not likely be where the "T" fittings are exactly vertical. The maker has solved this problem so that you are assured that all legs will be in the perfect vertical position once everything is tight. The setup is also nice and rigid once tightened. This is a huge benefit of steel pipe projects; they are really solid. The black finish is clearly very durable, like a powder coat. It appears that it will provide excellent protection against rust. Coverage is complete; I found no dings or scratches anywhere on any piece. Overall this is a very well-designed product for function and aesthetics. Perfect for a beautifully renovated warehouse condo where an industrial vibe is desired in a rock-solid table that won't shift around. The smoothness of the pipe is top notch. I've used lots of pipe in projects, some of it actual water pipe and some decorative pipe such as this. I've never seen better quality decorative pipe as this maker put in the effort to finish it beautifully smooth. At currently $34.99 I find the price quite reasonable too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
P
Verified Purchase
patricia
Lexington, US
★★★★★ 3
the height is only 16"
Size: coffee table leg
The height is only 16". From the description it appears to be 24" wide and 24" high.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
C
CMC20
Whiting, US
★★★★★ 4
Good DIY Pipe Legs but Powder Coat Quality Lacks
Size: side table leg, Size: side table leg
These industrial style pipe legs make building a DIY end table easy and the kit saves a trip to the hardware store. The fittings go together normally and assembly is simple. Comes individually wrapped. My main issue is the powder coating looks and feels cheap and rubs off easily. The pipes already had marks from touching each other from unboxing. If you do not mind some wear on the finish over time this is a decent purchase. The metal at the hardware store will be thicker and more durable but will cost more. I’d recommend based on ease of having a kit and it being delivered saving me a trip.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 30, 2025
M
Mark Weinberg
San Leandro, US
★★★★★ 5
Stable, attractive, and easy to turn into a table with your choice of top
Size: side table leg
The X-shape of the table legs - constructed with solid metal flanges, T-joints, X-joints and 1-inch diameter pipes - provides a strong and sturdy base for a wood top. The legs have adjustable feet pads to prevent scratches and ensure stability. Assembly of the legs is relatively simple (the instructions are clear) but you will need your own tools to attach a top. The industrial design is especially well suited to rec room or finished basement use. I am adding a 28" diameter raw edge slab of wood from a recently felled tree as the top and it is very attractive. (Photo unavailable because after I made certain it would work I sent the slab out for drying and finishing.) If you want a custom table and have a particular piece of wood you want to use, these legs are an excellent choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026

recommand products