SKU: 60042591362

RENIN (R66K) His Tag Protein, Human

Sale price$362.70 Regular price$403.00
Save 10%

Pay in installments of $100.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

RENIN (R66K) His Tag Protein, HumanProduct Specification Species Human Antigen Renin Synonyms REN, FLJ10761, Renin, angiotensinogenase Accession P00797 Amino Acid Sequence Leu24 Arg406 (R66K), with C terminal 8*His

Product Specification


Species Human
Antigen Renin
Synonyms REN, FLJ10761, Renin, angiotensinogenase
Accession P00797
Amino Acid Sequence

Leu24-Arg406 (R66K), with C-terminal 8*His LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKKLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 45-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Yokosawa, H. et al. (1980) J. Biol. Chem. 255:3498. 2. Fuminaki, S. et al. (2004) in Handbook of Proteolytic Enzymes, Barret, A. J. et al. eds. p. 54.

Background

Human Renin is a member of the aspartyl proteinase family produced largely in part by the juxtaglomerular cells in the kidney. Renin is also known as REN and angiotensinogenase, is a circulating enzyme that participates in the body's renin-angiotensin system (RAS), and plays an essential role in the elevation of arterial blood pressure and increased sodium retention by the kidney. Renin activates the renin-angiotensin system by cleaving angiotensinogen, produced by the liver, to yield angiotensin I, which is further converted into angiotensin II by ACE, the angiotensin-converting enzyme primarily within the capillaries of the lungs. Renin is secreted from kidney cells, which are activated via signaling from the macula densa, which responds to the rate of fluid flow through the distal tubule, by decreases in renal perfusion pressure (through stretch receptors in the vascular wall), and by sympathetic nervous stimulation, mainly through beta-1 receptor activation. Renin can bind to ATP6AP2, which results in a fourfold increase in the conversion of angiotensinogen to angiotensin I over that shown by soluble renin. In addition, renin binding results in phosphorylation of serine and tyrosine residues of ATP6AP2. The level of renin mRNA appears to be modulated by the binding of HADHB, HuR and CP1 to a regulatory region in the 3' UTR. An over-active renin-angiotension system leads to vasoconstriction and retention of sodium and water. These effects lead to hypertension. Therefore, renin inhibitors can be used for the treatment of hypertension. Renin differs from the other members of this class by having a pH optimum near the neutral pH region with native substrates instead of a pH 2.0 to 3.4 range.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 60042591362

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Ret. Teacher, Grandma & Hobby Farmer
Carnegie, US
★★★★★ 5
Comfy and Cool Shark Shirt
Number of Items: 1, Color: Ivory Sharks, Size: X-Small
We live near the beach, so I love finding ocean themed clothing for my little grandson. He loves this colorful swimming sharks crew neck t-shirt. He says it looks "cool." The cotton blend material is soft and and gentle against his skin. It's breathable and slightly stretchy. . The stitching is straight and consistent with no loose threads. We have fun talking about the different sharks, and the shirt looks great with his everyday jeans, joggers, or shorts. If you want some growing room, I suggest ordering a size up. The 5T is just a little long and roomy in the shoulders for my grandson who usually wears size 4. For laundering, I turn the shirt inside out and wash on cold to preserve the print. I haven't noticed any shrinkage or fading. I've been drying it on a warm setting (though cool is ideal), but I’m pretty careful not to leave it in the dryer too long to avoid wrinkles. He's been wearing it since his birthday in February, and so far, it's kept its shape, and seems to resist stains. If you have a little one that loves sharks, this check out this comfy ocean themed crew neck.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
S
Verified Purchase
SAMBILLZ
Phoenix, US
★★★★★ 4
Size up
Number of Items: 3, Color: Grey/Blue/Sea, Size: X-Small
Good quality but definitely size up one size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
A
Verified Purchase
Alice
Battle Creek, US
★★★★★ 5
True to size
Number of Items: 1, Color: White, Size: Large
This white undershirt was exactly what we ordered. The fit and quality met expectations, and it works perfectly for everyday wear. Simple, reliable, and a great value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
L
Verified Purchase
Lilyne
Chelsea, US
★★★★★ 5
Essential Tees
Number of Items: 5, Color: Navy, Size: XX-Large
Nice quality for some basic, essential tees. The ratio cotton to spandex makes it very comfortable to wear. Great value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
M
Verified Purchase
Meagan
San Leandro, US
★★★★★ 5
Good shirts
100% cotton. Yay! And thicker than the normal 100% cotton shirts I have found. Made well. Could do with better designs and colors but overall am happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026

recommand products