SKU: 60768293719

Human TNF-alpha, His Tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TNF-alpha, His TagProduct Specification Species Human Accession P01375 Amino Acid Sequence VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 19. 0 kDa (reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4

Product Specification


Species Human
Accession P01375
Amino Acid Sequence

VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight

19.0 kDa (reducing)

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 60768293719

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Suly
Phoenix, US
★★★★★ 4
Pretty
Very nice simple jewelry box. My only issue is spacing to put necklaces is a bit tight, but there is plenty of room in this little guy. I put a lighter next to it, for size comparison.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
S
Verified Purchase
Siddeek D. Ali
Draper, US
★★★★★ 5
Great item
Great item
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
K
Verified Purchase
Kindle Customer
Chelsea, US
★★★★★ 5
Chic little box
Perfect size for area. Holds plenty small jewelry items. Secure closure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
L
Verified Purchase
lilian napoles
Chelsea, US
★★★★★ 5
The storage space is perfect
Good size , not taking to much space and at the same time is enough for a lot of jewelry, easy closure, very pleased, I recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
L
Verified Purchase
Lauren
Birmingham, US
★★★★★ 5
Amazing Jewelry Travel Case
I bought this jewelry case for traveling on a cruise and I absolutely LOVE IT! When I purchased it I didn’t know if it would actually fit all the jewelry I wanted to bring but this box definitely impressed me! It fit all my regular jewelry plus more bc you know us woman love to coordinate with our outfits lol the case/box is sturdy! It didn’t break or even dent throughout my travels. It comes with different pieces to help organize and separate jewelry but it is removable if needed which I had to do bc one of my necklaces is really big. The case fit perfectly in my carry on luggage and didn’t take up much room at all which helped me a lot. I got the black case and I just love how simple and sleek it looks. This is definitely a must have if you need to travel with jewelry and are concerned about things getting damaged, this case keeps them safe and it’s definitely a great value for your money!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2024

recommand products