SKU: 63867414144

Frizzled-4/FZD4 His Tag Protein, Human

Sale price$155.25 Regular price$172.50
Save 10%

Pay in installments of $43.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Frizzled-4/FZD4 His Tag Protein, HumanProduct Specification Species Human Synonyms hFz4, FzE4, CD344, Frizzled 4, Fz 4, EVR1, CD344, FZD4S, FEVR, GPCR Accession Q9ULV1 Amino Acid Sequence Phe37 Glu180, with C terminal 8*His FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 28kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Human
Synonyms hFz4, FzE4, CD344, Frizzled 4, Fz-4, EVR1, CD344, FZD4S, FEVR, GPCR
Accession Q9ULV1
Amino Acid Sequence Phe37-Glu180, with C-terminal 8*His FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 20-28kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Nallathambi J. et al. (2006) Identification of novel FZD4 mutations in Indian patients with familial exudative vitreoretinopathy. Mol Vis. 12: 1086-1092.

2、Sjöblom T. et al. (2006) The consensus coding sequences of human breast and colorectal cancers. Science. 314(5797): 268-274.

Background

Frizzled-4, designated CD344, is a 7-transmembrane glycoprotein of the Frizzled family within the G-protein coupled receptor superfamily. Frizzled proteins function as receptors for Wnt proteins and can activate canonical Wnt/beta-catenin signaling as well as planar cell polarity and calcium flux pathways. Frizzled-4 is particularly important in angiogenic Wnt pathway signaling. Frizzled4 plays a crucial role in maintaining the integrity of the blood-brain barrier/blood-eye barrier, and regulating the expression of related proteins in the Frizzled4/Norrin pathway can regulate the switching of the blood-brain/blood-eye barrier. Frizzled-4 plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP).
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 63867414144

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
TD
Fort Morgan, US
★★★★★ 5
A very effective sunscreen at a very reasonable price
Style: 4 Fl Oz (Pack of 1)
This sunscreen is very reasonably priced but would I love about this product more than anything is how effective it is at protecting your skin and will be my first go to when purchasing a sunscreen, and for a man, it is best to be clean shaven when using, and not to put on too much as it will make you look like Casper the ghost if you do
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
A
Verified Purchase
Alvin English
Battle Creek, US
★★★★★ 5
No scent and blends in surprisingly well.
Style: 4 Fl Oz (Pack of 1)
Eucerin 50 (Sensitive Mineral - Zinc Oxide) Expiration date: Sept. 2026 Purchase date: May 2025 The most noticeable ingredients in the sunscreen are zinc oxide, mineral oil, and a yellow tint. The sunscreen is not scented which is always a plus. The yellow tint was not noticeable on my deep bronze skin. My skin is sensitive to many chemical products but not this one. The product blended in well into my skin both when dry and when using a moisturizing toner. There was not a white cast after giving it a few minutes to be absorbed by the skin. Most oil-based sunscreens leave my skin feeling greasy when perspiring but the Eucerin 50 was a pleasant surprise. The perspiration felt normal and not greasy. Overall, I am very pleased with the product. It is great for active people who normally sweat away sunscreen. Eucerin 50 left my skin feeling very soft after washing it off. This is the first mineral oil-based sunscreen that I have found to be satisfactory. I believe it to be a good value at the twenty-dollar or less price range. Warning!: It can stain your clothing. Do not store oil-based sunscreens in a hot environment like your automobile. The ingredients will separate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2025
M
Verified Purchase
mawissacee
Charlottesville, US
★★★★★ 5
I've tried MANY sunscreens. This is the best for the money you can buy.
Style: 4 Fl Oz (Pack of 1)
I have a section in my closet reserved for the graves of past sunscreens. And there are A LOT. Reasons why this is the best for price point: 1. No white cast. Maybe 2%. Yes, there is a bad a white cast when you first put it on, especially if your face is still a tad damp from washing. But it almost completely disappears within minutes. And this is coming from someone who is of Southeast Asian descent, and currently have a natural a tan this time of year. I get tan because I don't apply it every 2 hours as recommended. I only use it when I'm working out outside and the sun is blasting my face. I live where it gets very sunny. 2. NOT oily. I have super oily skin and so many of my sunscreens makes my face more of an oil slick than normal. I have matiffying ones, that work well, but it gets expensive. 3. Fragrance free! I prefer to use as many fragrance-free products as possible. 4. DOESN'T STING EYES. I'm surprised at how many "sunscreens for the face" are out there that absolutely sting my eyes into waterworks. 5. Price-point. A giant tube (for the face) for all that? It will take me a very long time to go through it. For my body, I use cheaper fragrance-free mineral sunscreens, or sunscreens I want to get rid of. 6. I use a moderate strength prescription of Tretinoin, and those who know, know that without sun protection, the skin can get burned and irritated extremely easily. Not me! And I use Tretinoin every single night. I'm so glad Eucerin made this, I hope they never discontinue this!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2022
M
Verified Purchase
Mary Ackert
Massapequa, US
★★★★★ 1
Awful for normal/combo skin types!
Style: 4 Fl Oz (Pack of 1)
Terrible for normal/combo skin! I applied sunscreen to my clean, dry face – without moisturizer. After waiting 25 minutes, I checked to see if the product hadn’t absorbed into my skin. It remained on top of my skin in a shiny, slippery, greasy film that rubbed off onto anything it touched. It’s settled thickly into crevices and fine lines, especially in the folds of my eyelids. There was so much shine – not glow – on my skin that it created flashback when I took a picture. Somehow, the sunscreen made my skin appear both oily and dry at the same time! Many other reviewers said that they successfully put make up over this sunscreen, but I cannot imagine how this would be successful, unless the makeup finish was incredibly matte. It’s the worst experience I’ve ever had with any sunscreen!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
N
Verified Purchase
Nikki Dalene
Chelsea, US
★★★★★ 5
Great sunscreen that smells good too!
Style: Kids SPF 50, Size: 5 Fl Oz (Pack of 1), Style: Kids SPF 50, Size: 5 Fl Oz (Pack of 1)
This stuff actually smells good and the scent doesn't smell like chemicals. It comes out clear which is perfect because I bought it for my little blonde headed, fair skinned 16 month old. It's nice to not have his hair looking all weird with white sunscreen spray. Overall, very pleased with it! Came just in time for our trip to the zoo the other day!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 25, 2025

recommand products