SKU: 65654209826

CD7 Ligand/SECTM1 Fc Chimera Protein, Human

Sale price$226.80 Regular price$252.00
Save 10%

Pay in installments of $63.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 Ligand/SECTM1 Fc Chimera Protein, HumanProduct Specification Species Human Antigen CD7 Ligand Synonyms CD7 Ligand, SECTM1, K12 Accession Q8WVN6 Amino Acid Sequence Gln29 Gly145, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen CD7 Ligand
Synonyms CD7 Ligand, SECTM1, K12
Accession Q8WVN6
Amino Acid Sequence

Gln29-Gly145, with C-terminal Human IgG1 Fc QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 44-49kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lyman S D. et al. (2000) Identification of CD7 as a cognate of the human K12 (SECTM1) protein. J Biol Chem. 275(5): 3431-3437.

2、Lam G K. et al. (2005) Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma. J Clin Immunol. 25(1): 41-49.

Background

SECTM1 (secreted and transmembrane 1), also called K12, is either found as an approximately 27 kDa intracellular type I transmembrane protein that shows a perinuclear, Golgi like staining pattern, or as a 20 kDa soluble, secreted form. SECTM1 is expressed on thymic epithelial and fibroblast cells, breast cancer and leukemia cell lines, and neutrophils but not in peripheral lymphocytes. SECTM1 is expressed on cytomembrane, which is identified as a CD7 ligand.CD7 is expressed in T and natural killer (NK) cells, which could be activated by its ligand SECTM1, thus promoting the proliferation of T and NK cells. SECTM1 strongly costimulates CD4 and CD8 T cell proliferation and induces IFN-γ production, likely via a CD7-dependent mechanism. In addition, SECTM1 synergizes with suboptimal anti-CD28 to strongly augment T cell functions. A robust induction of IL-2 production when SECTM1 and anti-CD28 signals were present with TCR ligation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65654209826

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Shark
Louisville, US
★★★★★ 5
Prints great, wifi was an issue
Style: Printer & Inks
Got the printer a week ago and have printed something every day so far and the quality of the prints have been fantastic. Arrived and set up without any major issues, other than not being able to connect to my local wifi. Had to get an Ethernet cable to connect to it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
S
Verified Purchase
S. Robson
Lake Worth, US
★★★★★ 5
Good printer
Style: Printer & Inks
It is working well for sublimation. No issues so far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
C
Verified Purchase
claudia
Massapequa, US
★★★★★ 5
Easy to assemble and quality
Style: Printer & Inks, Style: Printer & Inks
Using my printer almost everyday since Im starting on a sublimation project and I just love it. The printing quality look good The set up was easy and for now Is working 100%
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
N
Verified Purchase
Nadiagne
Bozeman, US
★★★★★ 5
Great 🥰
Style: Printer & Inks, Style: Printer & Inks
The Epson F170 has been ideal for getting started with sublimation. It's easy to use, prints vibrant and defined colors, and has allowed me to personalize various projects with excellent results. As a beginner, it has given me a lot of confidence to learn and create without complications. I definitely recommend it for anyone starting out in sublimation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
J
Verified Purchase
jesus hernandez
Massapequa, US
★★★★★ 5
100% recommended.
Style: Printer & Inks
It is an affordable and nice printer for those how wants to start a sublimation printer business. It’s works so good. I am using it to heat press cellphone case and it works amazing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026

recommand products