SKU: 65670517921

VHL/Elongin-C/Elongin-B Complex Protein, Human

Sale price$106.20 Regular price$118.00
Save 10%

Pay in installments of $29.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VHL/Elongin-C/Elongin-B Complex Protein, HumanProduct Specification Species Human Antigen ELOB ELOC VHL Synonyms Elongin B & Elongin C & VHL, ELOB & ELOC & VHL Complex, Elongin B & Elongin C & VHL Complex Accession Q15370Q15369P40337 Amino Acid Sequence ELOB flag tag, Human, Asp2 Gln118, N flag DYKDDDDKDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ ELOC flag tag, Human, Asp2 Cys112, N flag

Product Specification


Species Human
Antigen ELOB/ELOC/VHL
Synonyms Elongin B & Elongin C & VHL, ELOB & ELOC & VHL Complex, Elongin B & Elongin C & VHL Complex
Accession Q15370、Q15369、P40337
Amino Acid Sequence

ELOB flag tag, Human, Asp2-Gln118, N-flag DYKDDDDKDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ ELOC flag tag, Human, Asp2-Cys112, N-flag DYKDDDDKDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC VHL His tag, Human, Pro2-Asp213, N-His HHHHHHHHHHGGGSGGGSPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Expression System Baculovirus-InsectCells
Molecular Weight 14 kDa (ElOB) and 13.3 kDa (ElOC) and 25.9 kDa (VHL)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 40mM Tris, 200mM NaCl, 2.2mM KCl, 20% glycerol, 3mM DTT, pH8.0
Reconstitution N.A
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1.Cell Chem Biol. 2023 Jul 20;30(7):766-779.e11. Epub 2023 Jun 23.
2.bioRxiv. 2023 May 24;2023.05.22.541439. PreprintOkumura F., et al. (2012) Front. Oncol.
3.Mod Pathol. 2023 Apr 23;36(8):100194. Online ahead of print.

Background

ELOB (elongin B) is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. ELOB and ELOC(elongin C) form a heterodimer that serves as the regulatory subunit for the Elongin complex-a general transcription elongation factor that increases RNA Polymerase II transcription through template-encoded arresting sites. The ELOB/ELOC complex also binds to the "BC-box motif" found in many proteins in the VHL-box and SOCS-box protein families. The VHL(von Hippel-Lindau disease tumor suppressor) binds to ELOB and ELOC and thereby inhibits transcription elongation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65670517921

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Musicbookfan
San Leandro, US
★★★★★ 5
Incredible Comfort
Size: Large, Color: Multicoloured F (5-pack)
Amazing; I’ll be ordering more. Super soft, lightweight, smooth under clothes, incredible comfort! Best underwear! I ordered these because I’m tired of underwear lines when wearing biker shorts/leggings. Other boy shorts were too long or the bottom hem too thick and both of those issues left lines around my upper leg. THESE are *just right* - perfect length and fit. No panty lines on close fitting pants, comfortable under other pants and dresses, great with jumpsuits, and fit well under slip shorts with dresses. NOTE: These take longer to dry, than similar clothes, in the dryer. No shrinking though. SIZE: I ordered these in size L and they fit perfectly. A little snug when first on but they loosened up. For reference I’m 5’4” tall, about 175#, carry my weight in my hips and backside,wear size L sweats/pajamas/loose pants, size 12 jeans.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 23, 2025
K
Verified Purchase
Kathy M Gasperin
Natrona Heights, US
★★★★★ 5
Full coverage and full comfort
Size: XX-Large, Color: Multicoloured C (5-pack)
These boyshort underwear are a dream. They’re very soft, very stretchy, and very comfortable. They do not shrink when they’re washed. They’re heavy enough to make you feel like you have something covering you for discretion, but light enough to wear under any type of fabric. I have wide hips and I’m older so I don’t have a tight perky butt anymore. Most underwear tend to either ride up on me or become very uncomfortable. These stay where you put them. And they come all the way up to your waist so that there is no panty line whatsoever. The waist line is soft and comfortably. It does not dig in. They do not ride up and drive you crazy they stay where you put them. I would recommend them to anyone young or old. I have tried so many different styles and materials to find underwear that’s actually comfortable. These are the absolute best I have tried in five years. I just threw all the rest of them out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
J
Verified Purchase
Janet R Geisler
Phoenix, US
★★★★★ 4
Bamboo is an amazing fabric
Size: Large, Color: Multicoloured I (5-pack)
Comfy and soft . I’ve never worn boy shorts before so takes adjusting to. Legs roll sliding pants up but easy to adjust and smooth before zipping up then all day comfort. When I wear skirts or shorts they are perfect for that! I use to wear bike pants under skirts that don’t have to anymore. I like that they don’t creep up like regular underwear. I’m a new fan of bamboo fabric and bought briefs in bamboo as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
C
Verified Purchase
Cheryl L. Genet
Charlottesville, US
★★★★★ 5
The softest, stretchiest, perfect underwear!
Size: Large, Color: Multicoloured F (5-pack)
I have struggled for years to find underwear that didn't ride up. I like bamboo, but had the same problem with them. These Bamboo Cool Boyshorts not only solved my problem, but they are so soft and stretchy that it almost feels sensual pulling them on. They never ride up, roll down, they fit perfectly, and are always super comfortable. I even persuaded my husband to buy the men's version and he loves them too. And I should add, I never write reviews!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
A
Verified Purchase
Amy
Pawtucket, US
★★★★★ 5
YES!
Size: Medium, Color: Multicoloured D (5-pack)
I don't give too many items 5 stars, but these are reorder worthy! I bought these a year ago, and am now going back for another 5 pack; not because my first order wore out, but because they are still SO great, I want more! These are my go to for under dresses, skirts, & flowy pants where I want full coverage, but no panty lines! AND bonus, sweat absorption. The leg openings are a tight when I first put them on, but they stay put and are very comfortable. I get my normal size
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026

recommand products