Pay in installments of $65.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD79A His Tag Protein, HumanProduct Specification Species Human Synonyms CD79A, Ig alpha, MB 1 membrane glycoprotein, Membrane bound immunoglobulin associated protein, Surface IgM associated protein Accession P11912 Amino Acid Sequence Leu33 Arg143, with C terminal 8*His LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRGGGSHHHHHHHH Expression System HEK293 Molecular Weight 35 46kDa Purity >95% by SDS PAGE Endotoxin
Product Specification
| Species | Human |
| Synonyms | CD79A, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein |
| Accession | P11912 |
| Amino Acid Sequence | Leu33-Arg143, with C-terminal 8*His LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 35-46kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Venkitaraman A R. et al. (1991) The B-cell antigen receptor of the five immunoglobulin classes. Nature. 352(6338): 777-781. 2、Kim K M. et al. (1993) Signalling function of the B-cell antigen receptors. Immunol Rev. 132: 125-146. |
Background
CD79A encodes CD79a (also known as Ig-α) belonging to the Ig superfamily, a transmembrane protein that associate with CD79a(Ig-β) via a disulfide bond. CD79A and CD79B encoded by the mb-1 and B29 genes, respectively. CD79A and CD79B are proximal B-cell receptor subunits that contain an immunoreceptor tyrosine-based activation motif (ITAM) that frequently harbors somatic mutations. Ig-α and Ig-β form a disulfide-linked heterodimer that associates with membrane-bound Ig (mIg)3 molecules of every Ig class to form the B cell Ag receptor (BCR) complex. The variable region of the H and L (IgH and IgL) chains of the mIg molecules constitute the Ag-binding portion of the BCR, whereas the Ig-α/Ig-β heterodimer is its signaling component.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy