SKU: 66803206743

LAG-3/CD223 His Tag Protein, Mouse

Sale price$115.20 Regular price$128.00
Save 10%

Pay in installments of $32.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LAG-3/CD223 His Tag Protein, MouseProduct Specification Species Mouse Synonyms Lymphocyte activation protein 3 Accession Q61790 Amino Acid Sequence Gly24 Glu422, with C terminal 8*His

Product Specification


Species Mouse
Synonyms Lymphocyte-activation protein 3
Accession Q61790
Amino Acid Sequence

Gly24-Glu422, with C-terminal 8*His GPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGGVIWQHQPDSGQPTPIPALDLHQGMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEERGLQRGDFSLWLRPALRTDAGEYHATVRLPNRALSCSLRLRVGQASMIASPSGVLKLSDWVLLNCSFSRPDRPVSVHWFQGQNRVPVYNSPRHFLAETFLLLPQVSPLDSGTWGCVLTYRDGFNVSITYNLKVLGLEPVAPLTVYAAEGSRVELPCHLPPGVGTPSLLIAKWTPPGGGPELPVAGKSGNFTLHLEAVGLAQAGTYTCSIHLQGQQLNATVTLAVITVTPKSFGLPGSRGKLLCEVTPASGKERFVWRPLNNLSRSCPGPVLEIQEARLLAERWQCQLYEGQRLLGATVYAAEHHHHHHHH

Expression System HEK293
Molecular Weight

55-60kDa (Reducing)

Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. The LAG3 is Biased expression in spleen (RPKM 15.1), lymph node (RPKM 8.3) and 12 other tissues. Lymphocyte activation gene 3 (LAG3) is an inhibitory checkpoint protein expressed on activated T effector, T regulatory, and natural killer cells. The main function of LAG3 is the regulation of immune homeostasis. Several studies have suggested its role in malignant and autoimmune diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66803206743

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Panthersfan
Natrona Heights, US
★★★★★ 5
Great cabin air filter, very easy to install
Size: 1-Pack
.“Great, affordable cabin air filter that fit my 2024 Toyota Corolla Hybrid perfectly. My Toyota dealership wanted $60 to replace it, but I was able to install this one myself in under 15 minutes. Easy, cheap, and works exactly as it should.”
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
R
Verified Purchase
Ron Haas
Belleville, US
★★★★★ 5
Perfect fit and inexpensive
Size: 1-Pack
These are cheap and an easy fix to keep your car's HVAC running well. At this price you should replace these annually.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
B
Verified Purchase
Bradley Carlsen
Lowell, US
★★★★★ 5
Clean 2016 Prius
Size: 1-Pack
Fit my 2016 Prius good. I have had it installed for 10,000 miles and seems to work good still. With a nasty truck or old oil burner around me (windows up) I can smell some fumes but not much. Fumes might be coming from other sources like Worn window seals or firewall wire passages. If I flip the switch to recirculated air, I don't smell much. Great for the price and will buy another when I need it. Filter was great for winter driving. Better protection than stock. I forgot there was dog smell in the car.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
A
Verified Purchase
Amazon Customer
Omaha, US
★★★★★ 4
Good air filter
Size: 1-Pack, Size: 1-Pack
This cabin air filter looks well made and fits perfectly. Installation is very easy, and once installed you can notice cleaner airflow inside the vehicle. For the price, it offers solid performance and is a great alternative to the OEM filter. The only reason I’m giving it 4 stars instead of 5 is that the material feels slightly thinner than the original filter, so it may need to be replaced a bit more often. That said, it still filters well and works as expected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2025
A
Verified Purchase
Amazon Customer
Carnegie, US
★★★★★ 5
Great replacement cabin air filters
Size: 2-Pack
This cabin air filter was a perfect fit for my 2019 Camry XLE. Great price, too. I just took the old one out and popped the new one in, took about 2 minutes or less. Seems to be great quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026

recommand products