SKU: 67630778953

Human Galectin-3, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Galectin-3, His tagProduct Specification Species Human Synonyms 35 kDa lectin, Carbohydrate binding protein 35 (CBP 35), Galactose specific lectin 3, Galactoside binding protein (GALBP), IgE binding prtein, LGALS3, MAC2 Accession P17931 Amino Acid Sequence Protein sequence(P17931, Ala2 Ile250, with C 10*His)

Product Specification


Species Human
Synonyms 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding prtein, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Ala2-Ile250, with C-10*His)
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 27.8kDa Actual: 28kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 67630778953

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Renae Halvorson
Carnegie, US
★★★★★ 4
Value for your money
Style: EcoFetch
It's definitely different from the one I lost. It's taking me some time how to throw the ball correctly. It's a hit and miss but we are getting there. When I do get a good throw, it really wings it out there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
W
Verified Purchase
Will Brannies
Cuba, US
★★★★★ 5
Well worth it
Style: EcoFetch
Works great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
T
Verified Purchase
T
Dallas, US
★★★★★ 5
Dog hasn’t destroyed the ball yet!
The ball that comes with this is amazing. I have a 1 yr pitty that destroys everything! But this ball she has not been able to rip apart. I bought extra balls I was so impressed. She loves it too, takes it to bed with her.lol
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
L
Verified Purchase
Liz Acosta
Bozeman, US
★★★★★ 1
Cheaply made , waste of money
Cheap !! Lousy product did not fling at all. Lost the ball almost immediately since it went back instead of front. Do not recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 20, 2025
V
Verified Purchase
vagcharley
Boise, US
★★★★★ 3
So-so
Do not like this as much as previous one that broke after years. This one is cheap and sometimes the ball doesn't flip out well and doesn't pick up balls on the ground as easy but it does the job.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026

recommand products