SKU: 67706604415

Human CD62L , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD62L , His tagProduct Specification Species Human Synonyms L selectin, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte surface antigen Leu 8, Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90 MEL, SELL, LNHR, LYAM1 Accession P14151 Amino Acid Sequence Protein sequence(P14151, Trp39 Asn332, with C 10*His)

Product Specification


Species Human
Synonyms L-selectin, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90-MEL, SELL, LNHR, LYAM1
Accession P14151
Amino Acid Sequence Protein sequence(P14151, Trp39-Asn332, with C-10*His) WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:34.7kDa Actual:50-70kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. These tethering interactions are essential for the trafficking of monocytes and neutrophils into inflamed tissue as well as the homing of lymphocytes to secondary lymphoid organs. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. In addition to its function in the immune response, L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 67706604415

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Z
Verified Purchase
ZLJ
Birmingham, US
★★★★★ 5
Super soft and worth it
Color: Light Grey, Size: 2 Pack King(20"X 36")
Honestly really happy with these pillowcases. They feel super soft and cool when you sleep on them. My hair has been way less messy in the morning too. The quality actually feels pretty nice and the king size fit perfectly. Makes my bed feel a lot more comfortable and expensive looking. Definitely glad I bought them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
S
Verified Purchase
Shante Anderson
Waukegan, US
★★★★★ 5
SO WORTH THE PRICE
Color: Pink, Size: Queen(20"X 30")
I bought these in two colors for my new apartment with some new pillows to go on them because I got a whole new set of sheets and comforter for my bed and I have to say these are some of the softest most comfortable cooling pillow cases ever! The silk is not super great quality but for the price it's totally worth it I've noticed that it takes care of my hair better I never used silk pillow cases before... But I don't think I'll ever go back. And the zip closed with a zipper so they stay on your pillow no problem without sliding around and you having to fix them all the time they're so easy to use and they look perfect. They look exactly like the pictures! Definitely worth the price... Oh, and there's no weird smell or anything these are definitely good quality!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025
J
Verified Purchase
Jackie Scott
Alexandria, US
★★★★★ 5
Helps hair health.
Color: Lavender, Size: Queen(20"X 30")
Amazingly soft, cool and comfortable. The sizes are accurate so fit pillows easily. We mixed two colors so our bed looks as comfy and inviting with stylish color blending. Hair seems happy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
H
Verified Purchase
HollyGoL
Fort Morgan, US
★★★★★ 4
These give the benefits of a silk pillowcase on a budget.
Color: White, Size: Standard(20"X 26")
These are very nice pillowcases. Are these made from mulberry silk? I’d have to say no based on the burn test. However if anyone thinks they’re going to get a real mulberry silk pillowcase for this price, they need a reality check. I’ve purchased authentic mulberry silk pillowcases online from between $45 and $105. Most are $70 and up. I’ve bought a number of so called silk pillowcases up to $25. The Infiixso pillowcases are probably the nicest of this latter group. They have the right amount of sheen and the right amount of slip to them. They are very soft and went through the wash well in a mesh bag. I did put them in the dryer and meant to take them out after ten minutes but forgot them; taking them out after about 20 minutes on medium heat. One was a little wrinkly but it was in the mesh bag still. The other one came out fine. These fit my pillows without issue. The zipper seems to be sewn in well. The white is a true crisp white. These sleep cool and my hair glides across them so my hair looks better in the morning than if using a regular non-silk pillowcase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
R
Verified Purchase
Robert Z.
San Leandro, US
★★★★★ 5
RECOMMEND
Color: White, Size: 2 Pack Standard(20"X 26")
Warning: if you buy the color black, it will bleed and stain your pillows. This happened to me. I had to throw out my pillows. This issue does not sway my rating. The pillowcase is wrinkle-free and super soft. Fits standard-size and queen-size pillows. Quality and appearance are excellent. After my unfortunate purchase of the black pillowcases, I purchased the white, and I’m very happy I did. I gave a 5-star rating because they are beautiful and of great quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products