SKU: 6834952700

Human MUC4, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human MUC4, his tagProduct Specification Species Human Synonyms Ascites sialoglycoprotein (ASGP), Pancreatic adenocarcinoma mucin, Testis mucin, Tracheobronchial mucin Accession Q99102 Amino Acid Sequence Protein sequence (Q99102, Trp4683 Ser4918, with C 10*His)

Product Specification


Species Human
Synonyms Ascites sialoglycoprotein (ASGP), Pancreatic adenocarcinoma mucin, Testis mucin, Tracheobronchial mucin
Accession Q99102
Amino Acid Sequence

Protein sequence (Q99102, Trp4683-Ser4918, with C-10*His) WMFGDPHITTLDGVSYTFNGLGDFLLVGAQDGNSSFLLQGRTAQTGSAQATNFIAFAAQYRSSSLGPVTVQWLLEPHDAIRVLLDNQTVTFQPDHEDGGGQETFNATGVLLSRNGSEVSASFDGWATVSVIALSNILHASASLPPEYQNRTEGLLGVWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFYSQLQKNSSWAEHLISNCDGDSSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 27.3 kDa Observed MW: 35-50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Mucin-4 (MUC-4) is a mucin protein that in humans is encoded by the MUC4 gene. MUC-4 is a high-molecular weight glycoprotein. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. MUC-4 has been found to play various roles in the progression of cancer, particularly due to its signaling and anti-adhesive properties which contribute to tumor development and metastasis. It is also found to play roles in other diseases such as endometriosis and inflammatory bowel disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 6834952700

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Milton Mohr
San Leandro, US
★★★★★ 4
A Good Apologetics Primer
Format: Kindle
If you heard the word "apologetics" and are intrigued this is the primer for you to start your knowledge of apologetics.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2014
J
Verified Purchase
jayblyons
Carnegie, US
★★★★★ 3
Three Stars
Format: Paperback
It's exactly that. A little primer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2014
J
John Long
Charlottesville, US
★★★★★ 4
Great intro to for those who feel drawn to apologetics
Format: Kindle
James Sire has been a wonderful companion to many Christians who are called to use their intellect. I have been a fan of his ever since his book Scripture Twisting. Sire provides a great service to the Christian community first by identifying the many ways in which we engage in defense of the faith. We tend to think of great speakers in front of skeptical audiences, but there are many other ways in which apologetics is useful and necessary, such as when we are speaking to friends. Any time we are responding to their objections to Christianity, we can do so in a winsome and knowledgeable manner, even if we aren't an intellectual giant like Sire. Second, Sire identifies that types of personality characteristics and character traits necessary to pursue apologetics as a vocation. Of course, the primary characteristic is one of pursuing God. Included with this is some discussion about how we might recognize a calling in defense of the faith. Many pastors want to equip us in ministry, but Sire's discussion actually gets down to helping us recognize if this is our calling. Sire provides some pointers to great books on the major issues we might have to deal with. It's always good to have a book of great sources I also like the many examples he provides in his book about encounters with people, including mistakes he has made. I hope this will have a wide audience and encourage others to consider this calling.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2018
B
Verified Purchase
BG
Draper, US
★★★★★ 1
Weak
Format: Paperback
I very weak primer on apologetics. The author is really not convinced himself; so, it is difficult for him to present convincing arguments.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 9, 2013
M
Verified Purchase
Marlene
Omaha, US
★★★★★ 5
Helpful for newcomer
Format: Hardcover
I find this book helpful as a new MSK provider. A video component addition would be eben better
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2023

recommand products