SKU: 69157392152

HRSVA (strain A2) post-fusion glycoprotein F0, His Tag

Sale price$211.50 Regular price$235.00
Save 10%

Pay in installments of $58.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

HRSVA (strain A2) post-fusion glycoprotein F0, His TagProduct Specification Species HRSV Antigen HRSVA Synonyms Fusion glycoprotein F2, Fusion glycoprotein F1 Accession P03420 Amino Acid Sequence Gln26 Leu513, with C terminal 6* His

Product Specification


Species HRSV
Antigen HRSVA
Synonyms Fusion glycoprotein F2, Fusion glycoprotein F1
Accession P03420
Amino Acid Sequence

Gln26-Leu513, with C-terminal 6* His QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLGGGSHHHHHH

Expression System HEK293
Molecular Weight 43-45 kDa&18 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1. Melero J A. et al. (1997) Antigenic structure, evolution and immunobiology of human respiratory syncytial virus attachment (G) protein. J Gen Virol. 78 (10): 2411-2418. 2. Trento A. (2006) Natural history of human respiratory syncytial virus inferred from phylogenetic analysis of the attachment (G) glycoprotein with a 60-nucleotide duplication. J Virol. 80(2): 975-984.

Background

HRSV is a member of the Pneumovirinae subfamily in the Paramyxoviridae family. It consists of a non-segmented, single-strand negative RNA genome packaged in a lipid envelope. The genome of HRSV is about 15.2 kb in length and encodes 10 genes and 11 proteins: NS1, NS2, N, P, M, SH, G, F, M2-1, M2-2, and L. The F protein and G protein are the major surface glycoproteins. Both of them can stimulate the production of neutralizing antibodies. The sequence of the F protein is highly conserved, while that of the G protein is hypervariable. Due to the genetic diversity in the G gene, sequence encoding the second hypervariable region in the C-terminal (HVR2) of the G protein has been used for genotyping of HRSV. According to the genetic characteristic and reactivity with monoclonal antibodies, HRSV is classified into 2 subgroups, A (HRSVA) and B (HRSVB). To date, there are 15 genotypes of HRSVA (GA1-GA7, SAA1, CB-A, NA1-4 and ON1-2), and 24 genotypes of HRSVB (GB1-GB4, SAB1-SAB4, URU1-2, BA1-12, GB5/CB1 and CBB).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69157392152

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tiara Marie
Pawtucket, US
★★★★★ 5
So great, that I own 4 pairs of these Sampeel pants!
Color: Pattern Leopard, Size: Large, Color: Pattern Leopard, Size: Large
I own 4 pairs of these pants because I love them so much! I receive many compliments when I wear them. They are stylish, comfortable, and a great thin material that keeps you cool while looking professional. I am 5" tall and can wear them with heels without needing them to be hemmed (which is unusual for me when ordering pants). They have an elastic waist band with drawstrings so I can wear them while losing weight, they don't wrinkle easily, and they have pockets! Great pants for a great price! I will continue to purchase more throughout the summer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
G
Verified Purchase
Gina DiCarlo
Chelsea, US
★★★★★ 3
The good with the bad
Color: Pattern Kah, Size: XX-Large
Photos in listing depict a LINEN pant - in the close up's you can clearly see a linen/cotton like material. To my surprise, these pants are a silky, polyester material. There is NO stretch - I am glad I purchased a size larger than what I consider my " roomy " size. These style is also depicted as a beige and black color pattern, they are more of a light mauve color out of the packaging. Took a steamer to them to get the wrinkles out. Suitable for tall girls ( I am 5'9 ) and wearing them with 3 in wedge. They are cute - dressy enough for a business casual office setting or a date night. Probably not the best for hot humid weather as they are not breathable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
L
Verified Purchase
Lacy C.
Pawtucket, US
★★★★★ 5
Incredibly comfortable and perfect for summer!
Color: Pattern Leopard, Size: X-Large, Color: Pattern Leopard, Size: X-Large
I have to admit, I was a little skeptical about these pants at first. When I initially opened them, they didn’t feel like they had much stretch, and the fabric felt a bit cheap to the touch. However, once I actually put them on, my opinion completely changed! They are so incredibly comfortable and have a great, effortless drape. The material is lightweight and breathable, making them absolutely perfect for warm summer days. They are easy to style (looked great paired with a simple tank and a denim jacket!) and feel wonderful to move around in. I am so glad I gave them a chance—I would definitely purchase these again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
K
Verified Purchase
Kristi
Waukegan, US
★★★★★ 4
Cute and comfortable
Color: Pattern Leopard, Size: Medium
Comfortable and cute. A little long but still wear them with no issues. The material is light but synthetic so not really breathable. I foresee wearing them often.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
M
Verified Purchase
maxed
Fort Morgan, US
★★★★★ 5
Love these shirts
Size: Small, Color: Watermelon, Number of Items: 1
Love the fabric. They feel so much better than some of the other shirts I have. They’re thicker and just feel nicer. Love this color too. Got a small and also have another color in medium. Both fit, just depends on how casual I want to look. I’ll be getting more!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026

recommand products