Pay in installments of $74.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 18 - Aug 23
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD200 His Tag Protein, MouseProduct Specification Species Mouse Antigen CD200 Synonyms My033CD200 AntigenAntigen Identified By Monoclonal Antibody MRC OX 2MOX1OX 2 Membrane GlycoproteinOX 2MRCCD200 MoleculeMOX2 Accession O54901 Amino Acid Sequence Gln31 Gly232, with C terminal 8*His
Product Specification
| Species | Mouse |
| Antigen | CD200 |
| Synonyms | My033，CD200 Antigen，Antigen Identified By Monoclonal Antibody MRC OX-2，MOX1，OX-2 Membrane Glycoprotein，OX-2，MRC，CD200 Molecule，MOX2 |
| Accession | O54901 |
| Amino Acid Sequence |
Gln31-Gly232, with C-terminal 8*His QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 35-50kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Barclay A.N., Wright G.J., Brooke G., Brown M.H.CD200 and membrane protein interactions in the control of myeloid cells. TrendsImmunol. 2002;23:285–290. |
Background
CD200 is a type-1 cell membrane glycoprotein of the immunoglobulin supergene family, present on both cells with myeloid/lymphoid origin as well as on epithelial cells and many cancer cells. CD200, also known as MRC OX-2, is a highly conserved, 48 kDa type 1a transmembrane glycoprotein related structurally to the B7 family of costimulatory receptors.The molecule itself consists of an IgSF extracellular domain (single V + C), a single transmembrane region and a short cytoplasmic tail lacking signaling motifs. The molecule is expressed by resting dendritic cells, thymocytes, endothelial cells, neurons and osteoblast precursors (OBp), as well as by activated B and T cells (including αβTCR+ and most γδTCR+ cells). CD200 interacts with a structurally related receptor (CD200R) expressed mainly on myeloid cells and is involved in regulation of macrophage and mast cell function. OX-2 / CD200 and CD200R associate via their respective N-terminal Ig-like domains. CD200 also plays an important role in prevention of graft rejection, autoimmune diseases and spontaneous abortion.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy