SKU: 69750297576

Human VAV1 (SH3-2) Protein

Sale price$189.00 Regular price$210.00
Save 10%

Pay in installments of $52.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VAV1 (SH3-2) ProteinProduct Specification Species Human Synonyms Proto oncogene vav, VAV Accession P15498 Amino Acid Sequence Protein sequence (P15498, Lys782 Cys845) KYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC Expression System E. coli Molecular Weight Predicted MW: 7. 6 kDa Observed MW: 10 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized powder Storage Buffer Lyophilized from a 0. 2

Product Specification


Species Human
Synonyms Proto-oncogene vav, VAV
Accession P15498
Amino Acid Sequence

Protein sequence (P15498, Lys782-Cys845) KYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC

Expression System E.coli
Molecular Weight Predicted MW: 7.6 kDa Observed MW: 10 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

VAV1 is a crucial signaling protein that belongs to the VAV family of guanine nucleotide exchange factors (GEFs). It plays a pivotal role in hematopoietic cells, where it regulates cytoskeletal dynamics, cell migration, and immune responses by activating Rho-family GTPases such as Rac1 and Cdc42. The protein contains multiple functional domains, including a Dbl homology (DH) domain for GEF activity, a pleckstrin homology (PH) domain, and two Src homology 3 (SH3) domains, with the second SH3 domain (SH3-2) mediating protein-protein interactions. VAV1 is primarily expressed in T cells, B cells, and natural killer (NK) cells, where it participates in T-cell receptor (TCR) and B-cell receptor (BCR) signaling pathways. Dysregulation of VAV1 has been linked to autoimmune diseases and hematological malignancies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69750297576

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amanda
Lexington, US
★★★★★ 4
Cute but could use some pockets
Special Size: 6" Inseam Contrast Trim without Pockets, Size: Small, Color: Navy/White
Obsessed with these shorts. They are so cute and comfy. They fit true to size and I love that there is a matching top you can buy separately. I feel like the material is pretty thick and I don't have to worry about it being see through. My only complaint is that there are no pockets.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
A
Verified Purchase
Alecia
New York, US
★★★★★ 5
Perfect workout shorts!
Special Size: 5" Inseam without Pockets, Size: Medium, Color: Black
Very comfortable and soft material. Great price! Perfect for workouts! Doesn't ride up or have constant pulling on them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
A
Verified Purchase
anpsmom2
Los Angeles, US
★★★★★ 5
Nice fabric
Special Size: 7" Inseam with Pockets, Size: X-Large, Color: Taupe
These are well made. The fabric is perfect! Not thin. I was disappointed that I ordered a size that was too large. I had to return. I need to get updated body measurements before reordering.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
S
Verified Purchase
Stefan
Carnegie, US
★★★★★ 5
Buy buy buy!!!!
Special Size: 7" Inseam with Pockets, Size: Large, Color: Taupe
Fantastic! I got These a while back k in another color and needed another pair. I got the green, can you say wow! This color is beautiful and bright! They are as comfortable as my other ones! Worth every dime!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
A
Verified Purchase
Aubrey
Boise, US
★★★★★ 5
My favorite pair
Special Size: 7" Inseam with Pockets, Size: Large, Color: Black
The most comfortable pair of shorts I own. Material is soft, pockets are the perfect size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026

recommand products