SKU: 70611528306

CD34 Fc Chimera Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD34 Fc Chimera Protein, HumanProduct Specification Species Human Antigen CD34 Synonyms CD34 Molecule, CD34 Antigen, Hematopoietic Progenitor Cell Antigen CD34 Accession P28906 1 Amino Acid Sequence Ser32 Thr290, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen CD34
Synonyms CD34 Molecule, CD34 Antigen, Hematopoietic Progenitor Cell Antigen CD34
Accession P28906-1
Amino Acid Sequence

Ser32-Thr290, with C-terminal Human IgG1 Fc SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 72-100kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Civin C.I. et al. (1984) J. Immunol. 133:157. 2. Katz F. et al. (1985) Leuk. Res. 9:191. 3. Andrews R.G. et al. (1986) Blood 67:842.

Background

Cluster of Differentiation 34 (CD34) is a member of a family of single-pass transmembrane sialomucin proteins, and may function as a cell-cell adhesion factor by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.CD34 protein is selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues. It has been widely used as a stem and progenitor cell marker, and clinical CD34+ stem cell transplantation (CD34+SCT) has been performed for tumor purging. CD34 monoclonal antibodies are widely used to identify and isolate hemopoietic progenitors and to classify acute and chronic leukemias.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 70611528306

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Helen
Dallas, US
★★★★★ 5
Wow
Format: Kindle
Sexy, romantic and full of drama The Heartbreaker has it all. This book is a roller coaster ride and a true page turner
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
B
Verified Purchase
beefaith_reads
Omaha, US
★★★★★ 4
Perfect start to a new series!
Format: Kindle
Deliciously sexy in all the right ways! Piper Rayne, you've hooked me, and I'm now a fan for life. If you get the chance to listen to the audiobook, do it! It's duet, which includes several narrators in addition to Sean Masters and Erin Mallon, voicing side characters, which truly brings this hockey romcom to life. It's an absolutely delightful immersive read! Favorite Lines & Quotes: God, she’s ruining me, and I’m just letting her do it, but the last thing I want to do is om this. “You snuck up on me.” “You did, too. At a time when I didn’t believe in love or forevers.” “You’re the best surprise of my life.” We’ll have our arguments and disagreements, but I will forever remember that we have moments like this where we cherish and love one another. That will get us through the hard times. She’s found the man inside me I didn’t know was hidden, and I’m grateful for that because without her, I’m not sure he would have ever surfaced. Tropes & Themes: • Brother's best friend & teammate • Hockey romance • Found family • Swoon-worthy • Banter
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 22, 2025
G
Verified Purchase
Gris
Massapequa, US
★★★★★ 5
The heartbreaker
Format: Audiobook
Oh my gosh, why did I wait so long to read/listen to this book? I loved it so much I literally read it in less than record time. The chemistry between Rowan and Kyleigh was amazing and Kyleigh and her brother Conor’s bond was so heartwarming. The full cast of narrators did such a phenomenal job of bringing the characters to life that the story played out like a movie in my head and I ate it all up. Tropes: 💞Forbidden 🏒One Night Stand Secret Romance 💘 Reformed Playboy 🥅Hockey Romance 🚶‍♂️🚶🏻‍➡️Brothers Team Mate Narrator Cast: • Sean Masters • Erin Mallon • Connor Crais • JF Harding • Troy Duran • Teddy Hamilton • CJ Bloom
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026
A
Verified Purchase
Alexciz
Lowell, US
★★★★★ 4
THE P@SSION IN THIS STORY!!!
Format: Kindle
Wow! How could I ever forget how amazing Piper Rayne is?! Her writing is SO GOOD and captivating that I had to force myself to slow down as I just didn’t want this book to end. The MMC was super sweet and strong and loyal and not afraid to feel what he’s feeling. No, is is NOT a simp, he is just mature and once he decided he was in love, instead of running away in fear, he started making moves to show it. That is one who is in touch with his emotions for sure. Rowan was a dream boyfriend that I wish were real!! Then we had our FMC, Ryleigh who was a bit emotionally stunted due to something she had seen. She was NOT looking for Mr. Right, just Mr. Right now but boy oh BOY did the sparks fly between these two!! 🥵😮‍💨🔥. Their chemistry was off the charts and the spïcy scenes were so fre@king hot. Just woa, had me fanning myself constantly. The way they were portrayed as a couple showed a lasting connection that I was cheering for from chapter one. This was such an amazing story that I had to switch to reading it as well as I couldn’t stop when I got out of my car. (This started as an audible book but quickly became my every book)! With narrators like: Sean Masters,Erin Mallon, Connor Crais, JF Harding, Troy Duran, Teddy Hamilton and CJ Bloom?! there was no WAY I wasn’t buying this a fre@king all star cast like I’ve never had in a book before. These are literally almost all of my favorites, I was totally geeking out. All in all a great feel good story full of passion, heat, hurt and healing. Loved every minute of it. The side characters were so powerful I hope each guy gets his own book!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2025
C
Verified Purchase
Colleen S
Battle Creek, US
★★★★★ 5
An amazing book!!!
Format: Kindle
This was another amazing book by Piper Rayne! The nest is one of my favorite series (top 2 of all time)! The love story between Kyleigh and Rowan was beautifully written! I love the found family in this series! They always tell each other when they are messing up and always help each other fix their mistakes! The banter between them is soo well written. I highly recommend this book and the audiobook! The full cast audio book is beyond amazing!!!! It truly brought this wonderful story to life! The narrators did a fantastic job and really made me feel like I was a part of the story! I am such a sucker for a full cast audiobook! Another great job Piper Rayne and all the narrators that helped tell this awesome story!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025

recommand products