SKU: 71006314223

Mouse CD137, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD137, His tagProduct Specification Species Mouse Synonyms 4 1BB ligand receptor, T cell antigen 4 1BB, Tnfrsf9, Ila, Ly63 Accession P20334 Amino Acid Sequence Protein sequence (P20334, Val24 Leu187, with C 10*His) VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 19. 2 kDa Observed

Product Specification


Species Mouse
Synonyms 4-1BB ligand receptor, T-cell antigen 4-1BB, Tnfrsf9, Ila, Ly63
Accession P20334
Amino Acid Sequence

Protein sequence (P20334, Val24-Leu187, with C-10*His) VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19.2 kDa Observed MW: 28, 32 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD137, a member of the tumor necrosis factor (TNF) receptor family, is a type 1 transmembrane protein, expressed on surfaces of leukocytes and non-immune cells.[1] Its alternative names are tumor necrosis factor receptor superfamily member 9 (TNFRSF9), 4-1BB, and induced by lymphocyte activation (ILA). It is of interest to immunologists as a co-stimulatory immune checkpoint molecule, and as a potential target in cancer immunotherapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71006314223

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
john
Belleville, US
★★★★★ 5
Plush rug that’s super soft. WOW!
Color: Natural (Yellow-white Ivory), Size: 6' x 7' (Natural)
Beautiful and super plush! I use it as an outer blanket when cold weather camping. Like a modern day cave man. One of my favorite purchases. I avoid kneeling on it while it’s on my mattress fearing it might split the hide, or damage the stitching. It fits my queen size camper bed. Cant say enough!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 25, 2025
R
Verified Purchase
Rachel
Whiting, US
★★★★★ 5
Big Investment for a Lifetime of Quality
Color: Natural (Yellow-white Ivory), Size: 2' x 3' (Natural)
Several reviews mentioned a smell lingering with the sheepskin even after being unpacked a few days. I did notice the smell when I unpacked it, but I would expect a slight odor from such an item. It was not overpowering and is completely gone after one month of having it laid out on a chest in our bedroom. It is very functional, can be sat on, knelt on, etc, but is easily brushed off and looks great! The quality is very good…someone in my family is on it every night, and we have experienced no shedding whatsoever. Although the price is a big investment initially, I believe the quality is worthy. We plan to enjoy this beautiful sheepskin for a lifetime!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2025
L
Verified Purchase
Lillie
Alexandria, US
★★★★★ 4
Love it, but terrible smell at first
Color: Natural (Yellow-white Ivory), Size: 2' x 3' (Natural), Color: Natural (Yellow-white Ivory), Size: 2' x 3' (Natural)
Really soft & my dog loves it. I used it as a throw over my couch for decor. The smell when I took it out of the package was probably one of the worst smells I’ve ever smelled. Like old broccoli or something. I left it outside to air out all day and that was gone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2025
S
Verified Purchase
Sarah Legault | Teach Like a TopTEN™
Houston, US
★★★★★ 5
Luxurious Feel
Color: Grey Beige, Size: 2' x 3' (Natural)
Love this so much I’m ordering another one. Perfect look for furniture accents or for your pets. High quality and luxurious feel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 18, 2025
A
Verified Purchase
Amazon Customer
Whiting, US
★★★★★ 1
Not premium quality! I've seen actual authentic ones before.
Color: Natural (Yellow-white Ivory), Size: 2' x 3' (Natural), Color: Natural (Yellow-white Ivory), Size: 2' x 3' (Natural)
Despite all the positive reviews, I believe this product is subpar. There are genuine sheep skin Hydes but this product is NOT it. There is no leather embossing showing authenticity, and many signs of strong chemical treatment. Smell is lingering and I've aired them for over two days. Not very comfortable since the fur is very thick and coarse, you would expect it to be softer for the price as well. Not premium quality. I ordered this for my children to sleep on at long evening Church services but now I will look to more niche sellers for a higher quality product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2024

recommand products