SKU: 71246413849

Human CD1D Protein, His tag

Sale price$157.50 Regular price$175.00
Save 10%

Pay in installments of $43.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD1D Protein, His tagProduct Specification Species Human Synonyms Antigen presenting glycoprotein CD1d, R3G1, CD1d Accession P15813 Amino Acid Sequence Protein sequence (P15813, Val21 Gly296, with C His tag)

Product Specification


Species Human
Synonyms Antigen-presenting glycoprotein CD1d, R3G1, CD1d
Accession P15813
Amino Acid Sequence

Protein sequence (P15813, Val21-Gly296, with C-His tag) VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWG

Expression System HEK293
Molecular Weight

Predicted MW: 33 kDa Observed MW: 43-55 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD1D is a non-classical MHC class I-like glycoprotein specializing in lipid antigen presentation to T cells, particularly natural killer T (NKT) cells. Unlike classical MHC molecules, it presents lipid and glycolipid antigens via a unique binding groove. Expressed on antigen-presenting cells, CD1D bridges innate and adaptive immunity by activating NKT cells to secrete cytokines, influencing responses to infections, autoimmunity, and cancer. Genetic variants are associated with diseases like type 1 diabetes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71246413849

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LindseyLove
Bozeman, US
★★★★★ 4
I liked them, toddler did not
Size: 7 Toddler, Color: Navy
I thought these were cute shoes. They were sturdy, protective, and flexible for little walkers. And they were pretty soft on the inside to wear without socks. Unfortunately, my two year old did not agree. He cried "don't like it" and immediately ripped them off every time I tried them on him. Maybe it's just my picky son. TTS/half size big.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2024
A
Verified Purchase
Amazon Customer
New York, US
★★★★★ 5
Perfect for Toddlers
Size: 8 Toddler, Color: Navy
These are great for toddlers! Keeps my grandson’s toes safe yet cooler than sneakers for the summer. He loves them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
S
Verified Purchase
Sashunia
Omaha, US
★★★★★ 5
Great looking shoe!
Size: 11 Little Kid, Color: Tan, Size: 11 Little Kid, Color: Tan
We got these sandals specifically for our Caribbean vacation over thanksgiving break. They run true to size but I did get them one size bigger to hopefully last for next summer as well. They look great on and go with everything! My son said they feel very comfortable on his feet and he likes easy on/off due to Velcro closure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2025
A
Verified Purchase
Amy Kim
Lowell, US
★★★★★ 5
The Perfect Sandal for Active Kids!
Size: 8 Toddler, Color: Navy
I recently purchased the Stride Rite 360 Boy's Paddy Sandal for my son, and I couldn't be happier with my decision! From the moment he slipped his feet into these sandals, I could tell we were both going to be very pleased. Comfort & Fit: 5/5 - The Paddy Sandal has surpassed all expectations in terms of comfort and fit. The adjustable straps make it incredibly easy to get a snug, perfect fit for my son's feet, ensuring the sandals stay securely on, no matter how much running and jumping he does. The soles are cushioned just right, offering support without sacrificing flexibility, which is essential for a growing child. Durability: 5/5 - Stride Rite has always been synonymous with quality, and these sandals are no exception. They've endured days at the park, sandy beaches, and endless pavement adventures, yet they show minimal wear and tear. The materials are top-notch, promising many more months of active use. Ease of Use: 5/5 - For busy parents, the ease with which these sandals can be put on and taken off is a huge relief. The hook and loop closure is strong and stays in place, but it's simple enough for my son to handle on his own, fostering his independence. Overall Experience: 5/5 - It's rare to find a shoe that ticks all the boxes for both parent and child, but the Stride Rite 360 Boy's Paddy Sandal does just that. They've been a fantastic investment in my son's summer wardrobe and overall comfort during his daily activities. I would highly recommend these sandals to any parent looking for a reliable, comfortable, and stylish option for their child. Stride Rite has outdone themselves once again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2024
S
Verified Purchase
Spensanna Mayberry
Carnegie, US
★★★★★ 5
Great
Size: 8 Toddler, Color: Navy
Just as pictured and the padding is super comfortable, our 3 year old is rough on shoes but we love stride rite the quality it good and easy to clean perfect for wide toe area
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026

recommand products