Pay in installments of $61.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 13 - Aug 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Biotinylated CD47 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CD47, MER6, IAP, OA3 Accession Q08722 Amino Acid Sequence Gln19 Pro139, with C terminal Human IgG1 Fc & Avi Tag
Product Specification
| Species | Human |
| Synonyms | CD47, MER6, IAP, OA3 |
| Accession | Q08722 |
| Amino Acid Sequence | Gln19-Pro139, with C-terminal Human IgG1 Fc & Avi Tag QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE |
| Expression System | HEK293 |
| Molecular Weight | 55-65kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Biotin |
| Tag | Human Fc Tag, Avi Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135. 2、Oldenborg P A. (2004) Role of CD47 in erythroid cells and in autoimmunity. Leuk Lymphoma. 45(7): 1319-27. 3、Kaczorowski D J. et al. (2007) Targeting CD47: NO limit on therapeutic potential. Circ Res. 100(5): 602-603. |
Background
The leukocyte surface antigen CD47 is also known as OA3, integrin-related protein (IAP), and protein MER6. Human CD47 is an integral membrane protein consisting of a 123-amino acid (aa) extracellular domain (ECD) and a single Ig-like domain, five transmembrane regions with short insertion loops, and a 34-aa C-terminal cytoplasmic tail. CD47 is widely distributed in normal adult tissues. CD47 is a receptor for SIRPA, and binding to SIRPA prevents the maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells, thereby protecting cancer cells from elimination by phagocytosis. The interaction between CD47 and SIRPG mediates cell-cell adhesion, enhances superantigen-dependent t cell-mediated proliferation, and co-stimulates t cell activation. CD47 is highly expressed in a variety of solid tumor cells and malignant hematological tumor cells, and its expression level is positively correlated with disease progression.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy