SKU: 73937436405

B7-H7/HHLA2 His Tag Protein, Cynomolgus

Sale price$216.00 Regular price$240.00
Save 10%

Pay in installments of $60.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

B7-H7/HHLA2 His Tag Protein, CynomolgusProduct Specification Species Human Synonyms B7 H7, HHLA2, B7 Homolog 7 Accession XP_005548285 Amino Acid Sequence Ile21 Asn345, with C terminal 8*His

Product Specification


Species Human
Synonyms B7-H7, HHLA2, B7 Homolog 7
Accession XP_005548285
Amino Acid Sequence

Ile21-Asn345, with C-terminal 8*His IFLSAFFTYVPMNEQIIIGRLGEDIILPSSFERGSEVVIHWKYQDSYNSYNVHSYYKGSGRLESQDTRYANRTSLFYNEIQNGNASLFFRRLSLLDEGIYTCYVGTAIQAITNKVVLKVGVFLTPMMKYEKRNTNSFLICNVLSVYPRPIITWKMDNTPISENNMQETGSLGPFSINSTLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCELVNDYFSPNQDFKVTWSRMESGISSILAYYLSSSQNTTFYESRFSWNKELKNQSDFSMNLTDLSLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASDNGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 60-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Zhu Y. et al. (2013) B7-H5 costimulates human T cells via CD28H. Nat Commun. 4.

2、Dong Z. et al. (2018) EGFR may participate in immune evasion through regulation of B7-H5 expression in non-small cell lung carcinoma. Mol Med Rep. 18: 3769-3779.

Background

Human endogenous retrovirus-H long terminal repeat-associating protein 2 (HHLA2; also known as B7H7 or B7H5) is the only member of the B7 protein family found in humans. HHLA2 cannot be found in mice and is mainly expressed in human breast, lung, thyroid, melanoma, pancreas, ovary, liver, bladder, colon, prostate, kidney and esophagus cancer cells, activated myeloid cells, monocyte-derived macrophages and dendritic cells. In addition, HHLA2 interacts with the co-receptor CD28H to stimulate T cell proliferation, differentiation and the production of cytokines, including IFN-γ, IL-2 and IL-10. In terms of cancer, higher expression levels of HHLA2 were previously reported to be associated with poorer prognoses or higher degrees of tumour invasion in lung carcinoma, hepatocellular carcinoma and prostate cancer.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 73937436405

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Janola
Waukegan, US
★★★★★ 5
Great Value for Cool Thigh Protection
Color: 02-multicolour (4-pack), Size: XX-Large
For the price, I'm not sure there are better women's boxer shortlettes anywhere. I've tried more expensive brands, and for quality and cooling, these are right up there. I have other bamboo viscose undies that still get gross when I get sweaty in the summer, but these, with the large mesh panel, really help wick away a lot of that moisture, keeping you feeling dryer and cooler. I find that the leg openings are comfortable and don't roll up! and the waist band doesn't dig, nor does it roll down. These do not provide any compression, and I wasn't looking for any. I just wanted some cooling, thigh protecting women's boxers that wouldn't break the bank. These are them! Bonus- I've washed them and put them in the dryer (following their instructions), and they haven't shrunk; they look about the same and are nice and soft.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2025
R
Verified Purchase
Reviewer
Bozeman, US
★★★★★ 4
Great for the entire family but expensive
So far so good. The brand of boxers we had been buying changed their style and construction so we needed to find an alternative. These have held up well so far to multiple weeks of frequent washing and wearing from the entire family. We did size up from the usual 6/M we normally buy and ordered large to prevent the legs from rolling up which worked out great. Our daughter likes the length and how soft the fabric is for wearing under skirts and gym shorts and liners stay put without moving or leaking as another reviewer mentioned. Our son says they are comfortable and fit well being just supportive enough without being constrictive. We all agree that there seems to be not enough fabric in the back as they tend to be much tighter across the backside than the front and that also causes the waist band to ride lower in the back than the front. These have better seam placement than some brands we tried with no seam across the lady bits and no seam down the middle of the back side so they are more much comfortable but the cost is also much higher and that is why we're only giving it 4 stars. These will stay in the rotation until we find something cheaper that both us and the kids like.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2026
B
Verified Purchase
Brittany
Battle Creek, US
★★★★★ 5
Pregnant lady review! Soft, comfortable, cool.
Color: 03-multicolour (4-pack), Size: Large
So soft, comfortable and cool. I'm pregnant and I've gained weight in my legs. I love wearing dresses but my thighs were rubbing together too much. These are perfect to wear under dresses. I also wear them under my bibs at work and it keeps me from getting overheated but I don't have to worry about whether or not my underwear show since they just look like shorts. I wish these came in maternity. I just keep them below my belly. I'll be buying more for sure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
J
Verified Purchase
Janessa L.
Fort Morgan, US
★★★★★ 5
I want to live in these
Color: 01-multicolour (4-pack), Size: Medium
I bought 4 different sets of new underwear. Unfortunately these came last. It’s unfortunate, because if they had come first I would have cancelled all my other orders or returned them and ordered more of these. I never want to wear anything else ever again; these are the comfiest undies I’ve ever owned, I want to live in them. I can wear them under pretty much anything except leggings or very tight pants (but let’s be honest, I don’t wear those anyway.) They are incredibly soft and breathable, they wash well, don’t roll, keep my thighs from rubbing, are comfy to sleep in, and the colors were true to the photo. Just a heads up, they are on the thin side and just a bit see through in the rear. I’m 5’5” 140lbs and the mediums fit perfectly, they go about mid-thigh.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 30, 2025
P
Verified Purchase
Pistol King
Los Angeles, US
★★★★★ 5
Extremely comfortable
Color: 02-multicolour (4-pack), Size: X-Large
These are by far the softest and most comfortable underwear I have ever owned. The leg portion absolutely does roll up as so many others have mentioned, however, I did not find that to be uncomfortable at all just annoying that they don’t stay in place. I bought these specific underwear to see if it would help alleviate HS symptoms at all. They have definitely helped with wicking moisture away from the skin. More time will tell if it’s truly helpful for HS. For now, I will recommend these. They are thin, breathable, butter soft, wick moisture comfortable and I would buy again…maybe in a different style next time. I have washed them several times and they seem to be holding up rather well so that is also of supreme importance given the cost of the item. Again, I would recommend this item and plan on purchasing more in a different style very soon.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 13, 2025

recommand products