SKU: 86338277998

Rat Ig gamma-1 chain C region, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat Ig gamma-1 chain C region, His tagProduct Specification Species Rat Accession P20759 Amino Acid Sequence Protein sequence (P20759, Ala1 Lys326, with C 10*His)

Product Specification


Species Rat
Accession P20759
Amino Acid Sequence

Protein sequence (P20759, Ala1-Lys326, with C-10*His) AETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNCGGDCKPCICTGSEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISQDDPEVHFSWFVDDVEVHTAQTRPPEEQFNSTFRSVSELPILHQDWLNGRTFRCKVTSAAFPSPIEKTISKPEGRTQVPHVYTMSPTKEEMTQNEVSITCMVKGFYPPDIYVEWQMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKEKWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 37.6 kDa Observed MW: 45-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Ig gamma-1 chain C region (IGHG1) is considered an emerging prognostic marker. The upregulation of IGHG1 is strongly associated with various malignancies, including colorectal cancer, gastric cancer, prostate cancer, papillary thyroid carcinoma, leukemia, ovarian cancer, and breast cancer. In colorectal cancer, the upregulation of IGHG1 contributes to increased cellular proliferation. MEK-FECH signaling is upregulated in IGHG1-overexpressing colorectal carcinomas. IGHG1 overexpression has also been reported for the induction of epithelial to mesenchymal cell transmission (EMT) in gastric cancer via tumor growth factor beta (TGF-β)/SMAD3 signaling. In prostate cancer, the inhibition of IGHG1 is linked to the suppression of MEK/ERK/c-Myc signaling, leading to reduced malignant growth. The increased expression of IGHG1 in breast cancer cells activates AKT and vascular endothelial growth factor (VEGF) signaling, leading to enhanced cell proliferation, invasion, and angiogenesis. IGHG1-silencing can suppress the neoplastic characteristics of breast cancer cells in vitro and suppresses tumor growth in nude mice.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86338277998

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Bryan
Waukegan, US
★★★★★ 1
Bad quality
Style: Pants, Color: Pants Black, Size: 29, Style: Pants, Color: Pants Black, Size: 29
Very bad quality, so sheep
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 6, 2024
A
Verified Purchase
Amazon Customer
Battle Creek, US
★★★★★ 3
Black and white plaid pants
I recommend ordering one size up from your regulary size.This product is smaller than my actual paint size. When buying this product remember to order one size up from your normal size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 6, 2025
J
Verified Purchase
Jim Q
Natrona Heights, US
★★★★★ 5
Perfect Squidward Pants
Color: Aqua, Size: 34, Color: Aqua, Size: 34
If you’ve ever wanted to channel your inner Squidward Tentacles, these pants are an absolute must for your costume. They’re the ideal blend of comfort and style, with just the right amount of “meh” that screams Squidward in the best possible way. Fit and Comfort The pants are designed for ultimate comfort—just the right balance between relaxed and structured. They’re not too tight, which is perfect for anyone who wants to lounge around in true Squidward fashion. Plus, they have an easy, breezy fit that’ll let you sit at your “couch” for hours, begrudgingly watching the world go by—just like Squidward himself. The Look These pants nail the Squidward aesthetic. The neutral color (a perfect, unassuming beige or taupe) gives off that “I’m here, but I’m not excited about it” vibe, which Squidward fans will immediately recognize. The waistband sits comfortably at the natural waist, and the straight-leg cut gives you that ‘I’m-about-to-bore-you-with-my-monologue’ look. Perfect for the Costume When it comes to costumes, attention to detail is key, and these pants hit the mark. They’ve got that slightly too-perfectly-average vibe that’s Squidward in a nutshell. Whether you’re pairing them with a simple short-sleeved shirt for a quick DIY look or going full costume mode with a wig and clarinet, these pants are the foundation of any Squidward ensemble. Versatility While they’re ideal for a Squidward costume, they also function as perfectly mundane pants for any occasion where you want to blend in, exude minimal enthusiasm, and avoid doing anything that requires effort. They’re just the right kind of forgettable to fit with any everyday outfit, in case you feel like giving a nonchalant, “I’m fine, thanks” at your next casual gathering. Verdict: These pants aren’t just the cornerstone of a perfect Squidward costume—they embody the very essence of Squidward himself: stylishly indifferent, effortlessly bland, and somehow still perfect. Five stars for bringing Squidward’s look to life in the most comfortable, “meh” way possible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 26, 2024
R
Verified Purchase
RJB
Lake Worth, US
★★★★★ 5
Perfect red dress pants
Color: Red, Size: 32
These pants are legit! I got them as a backup to an American flag suit but they are my go-to red pants now. Very vibrant red, well made and good price. The length is purfecttt. I was worried they would be tight but the waist stretches and they look snd feel great on me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2026
R
Verified Purchase
romaningo smith
Carnegie, US
★★★★★ 5
He like them
Color: Red, Size: 42, Color: Red, Size: 42
Really nice too big in the waist
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2026

recommand products