Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 11 - Aug 16
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Biotinylated IL-15R alpha/CD215 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms IL 15RA, IL 15R alpha, Interleukin 15 Receptor Subunit Alpha, CD215 Accession Q13261 1 Amino Acid Sequence Ile31 Thr205, with C terminal human IgG1 Fc &Avi tag
Product Specification
| Species | Human |
| Synonyms | IL-15RA, IL-15R-alpha, Interleukin-15 Receptor Subunit Alpha, CD215 |
| Accession | Q13261-1 |
| Amino Acid Sequence | Ile31-Thr205, with C-terminal human IgG1 Fc &Avi tag ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE |
| Expression System | HEK293 |
| Molecular Weight | 72-80kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Biotin |
| Tag | Avi Tag, Mouse Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Clémentine Perrier , Ingrid Arijs, Dominiek Staelens, Christine Breynaert, Isabelle Cleynen, Kris Covens, Marc Ferrante, Gert Van Assche, Séverine Vermeire, Gert de Hertogh, Frans Schuit, Paul Rutgeerts, Jan L Ceuppens. (2013) Interleukin-15 receptor α expression in inflammatory bowel disease patients before and after normalization of inflammation with infliximab. mmunology. 138(1):47-56. |
Background
IL-15Ra chain is expressed by many cell types including monocytes, dendritic cells, natural killer cells, T cells and fibroblasts. Several isoforms of IL-15Ra exist and are generated either by alternative splicing or by proteolytic cleavage. Hence, IL-15Ra can be found as a membrane receptor or as a soluble receptor (sIL-15Ra); and as most isoforms of the receptor contain a sushi domain allowing very-high-affinity binding of IL-15, signaling or regulatory functions can be attributed to the receptor. Competition between soluble and membrane receptors can result in reduced biological activity of IL-15, though a super agonist effect of the soluble form was also observed. The signaling of IL-15 appears more complicated than for other cytokines because IL-15 primarily exists as a complex bound to IL-15Ra. When IL-15/IL-15Ra complexes are shuttled to the cell surface, they can stimulate opposing cells through the b/cC receptor complex (trans-presentation), or alternatively may allow an autocrine stimulation (cis-presentation).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy