SKU: 79597640824

Human Urokinase Protein, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Urokinase Protein, His tagProduct Specification Species Human Synonyms Urokinase type plasminogen activator, U plasminogen activator, uPA, PLAU Accession P00749 Amino Acid Sequence Protein sequence (P00749, Ser21 Leu431, with C His tag)

Product Specification


Species Human
Synonyms Urokinase-type plasminogen activator, U-plasminogen activator, uPA, PLAU
Accession P00749
Amino Acid Sequence

Protein sequence (P00749, Ser21-Leu431, with C-His tag) SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Expression System HEK293
Molecular Weight Predicted MW: 48.1 kDa Observed MW: 54 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Urokinase - type plasminogen activator is a serine protease that plays a crucial role in the fibrinolytic system. It is mainly produced and secreted by various cells, such as endothelial cells and monocytes. u - PA specifically converts plasminogen into plasmin, which is capable of degrading fibrin clots and extracellular matrix proteins. This process is essential for maintaining the balance of blood coagulation and fibrinolysis, as well as for tissue remodeling and wound healing. Dysregulation of u - PA has been implicated in many pathological conditions, including thrombosis, cancer metastasis, and inflammatory diseases. Therefore, u - PA is an important target for the development of drugs to treat these diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 79597640824

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Monica
Draper, US
★★★★★ 5
Puppy Crack!
Color: Pollen for You
Because its her only toy that crackels and the daisy (as in DaisyMae) flower moves up and down on the rope. DaisyMae loves it! Bee squeaks, flower dont, both do crinkle. But if you have a jaws of life puppy always going for your feet, its a great leg workout too. Well buit rope is nice to place in between your toes. Great buy. Super cute! Win Win! Toys are on the smaller size, perfect for a baby puppy learning a squeaker toy. Maybe 6 to 8 inches each. A nice buy for 13bucks.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
A
Verified Purchase
Amazon Customer
San Leandro, US
★★★★★ 5
Our dogs favorite toy
Color: Multicolor
The slothicorn is our dogs FAVORITE toy. The rainbow coloring is so cute. She loves playing with the unicorn horn. The horn is starting to fall off, but it's lasted a while since this is her #1 choice to play with. Will order another when it finally needs to be replaced. 10/10.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
B
Verified Purchase
Barbara S. Scholl
Lexington, US
★★★★★ 5
The best dog toy llama!
Color: Llama
My fur baby LOVES his stuffed llama!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
M
Verified Purchase
Minerva Jayne Van Allen
Phoenix, US
★★★★★ 5
Perfect Squeaky Toy for My Exes Deranged Dog
Color: Multicolor, Color: Multicolor
My ex-beau and I are still friendly and we exchange Christmas presents. This year, I wanted to make sure that his utterly nutty and completely bonkers Aussie, Diego, got a new toy so that he has added enrichment in his enclosure. Diego really enjoyed this toy! A perfect size for him and a loud squeaker, which my ex will undoubtedly appreciate being squeaked non-stop while he is trying to game with his various assortment of video game people. Worth every penny. Diego’s smiling face is proof of his delight in his adorable Slothicorn. Squeak away, Diego! Squeak away!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
B
Verified Purchase
BarbaraAnn
Whiting, US
★★★★★ 4
Fun
Color: Multicolor
A little smaller than we'd hoped but all in all he's pretty cool and our dogs loved him.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 5, 2025

recommand products