SKU: 8481042151

TOXGO SAG2(P22), His tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 6 - Aug 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TOXGO SAG2(P22), His tagProduct Specification Species TOXGO Synonyms Surface antigen P22 Accession Q9NBH0 Amino Acid Sequence Protein sequence(Q9NBH0, Ser27 Val187, with C 10*His) STTETPAPIECTAGATKTVEAPSSGSVVFQCGDKLTISPSGEGDVFYGKECTDSRKLTTVLPGAVLKAKVEQPPKGPATYTLSYDGTPEKPQVLCYKCVAEAGAPAGRNNDGGSSAPTPKDCKLIVRVPGADGRVTSGFDPVSLTGKVLAPGLAGLLITFVGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 18. 0kDa Actual: 21kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag

Product Specification


Species TOXGO
Synonyms Surface antigen P22
Accession Q9NBH0
Amino Acid Sequence

Protein sequence(Q9NBH0, Ser27-Val187, with C-10*His) STTETPAPIECTAGATKTVEAPSSGSVVFQCGDKLTISPSGEGDVFYGKECTDSRKLTTVLPGAVLKAKVEQPPKGPATYTLSYDGTPEKPQVLCYKCVAEAGAPAGRNNDGGSSAPTPKDCKLIVRVPGADGRVTSGFDPVSLTGKVLAPGLAGLLITFVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:18.0kDa Actual:21kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Toxoplasmosis is a parasitic disease caused by Toxoplasma gondii, an apicomplexan. Infections with toxoplasmosis are associated with a variety of neuropsychiatric and behavioral conditions. SAG2A is a 22 kDa protein that is mainly found in the surface of tachyzoites.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8481042151

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Laney
Pawtucket, US
★★★★★ 5
Perfect sheepskin rug
Color: Ivory, Size: 2'3" x 3'5" (Large Pelt)
This sheepskin rug is fabulous! I have it over my office chair and I LOVE it. It does not shed, it stays in place and fits over the seat and up the entire back of the chair with a bit remaining to hang over the edge. My cat sleeps on it every chance he gets. Great value for the price! Just looking at it brings me joy, such a beautiful sheepskin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
F
Verified Purchase
FRECKLEFRACK
Grantham, US
★★★★★ 5
Dog ignores, but I like
Color: Ivory, Size: 2' x 3' (Pelt), Color: Ivory, Size: 2' x 3' (Pelt)
I bought this for my dog, who is old and has creaky joints. My dog prefers to continue resting in uncomfortable places that put my plants in peril. He does not ever recline on this dead sheep and looks at me as though I am the sheep slaughterer. Spouse asked if it came in bigger sizes. Since this is the skin of a dead sheep, it depends on live sheep girth. Anything bigger would likely have to be sewn together from multiple dead sheep. I find the girth of this sheep pelt perfectly acceptable. It is nice and thick and soft and fairly easy to vacuum. I frequently recline on it when stretched out on the floor, and am grateful it does not leave a mess or make noise like my dog, who should be grateful that his pelt is still attached to his body.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2024
S
Verified Purchase
Sound Diva
Pawtucket, US
★★★★★ 1
SHRINK Wrapped. NO Customer Support.
Color: Ivory, Size: 2' x 3' (Pelt)
These arrived shrink wrapped and when put down as throw rugs, are lumpy. They are a little less so after 10 minutes on air fluff in the dryer. They look nice and fit my bedroom well but I’m concerned about walking over them since I prefer a level surface that is even. Customer support does NOT exist. There appears to be a chat option but there are no responses. Reading other information, I’ve decided to try a metal comb. So now I’m waiting for that to arrive. If it wasn’t so difficult to deal with the size difference, I would have simply returned them. I may still and just purchase a return container.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2026
F
Verified Purchase
farmer
Lowell, US
★★★★★ 5
100 % genuine sheepskin.
Color: Ivory, Size: 2' x 3' (Pelt)
Just received today. Beautiful sheepskin rug. 100 percent natural long fibers. As the listing states..."it has the wrong labei". That must be why the "experts" complained. Out of several rugs i own, this one is the nicest. Slight smell but airing it out will take care of that.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2025
M
Verified Purchase
mparker
Los Angeles, US
★★★★★ 4
Overall good quality
Color: Ivory, Size: 2' x 3' (Pelt), Color: Ivory, Size: 2' x 3' (Pelt)
I was pleasantly surprised by the thickness of this rug. No bad smell coming off it. I like the leather backing on it. Wasn't as soft/fluffy straight out the bag but a quick brush fixed that issue for me. So far even with the brushing there is minimal shedding. Bought as a gift for my husband but my son enjoys it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2023

recommand products