SKU: 84965120781

E-Selectin/CD62E His Tag Protein, Human

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

E-Selectin/CD62E His Tag Protein, HumanProduct Specification Species Human Antigen E Selectin CD62E Synonyms SELE, ELAM1, ESEL, LECAM2 Accession P16581 Amino Acid Sequence Trp22 Pro556, with C terminal 10*His

Product Specification


Species Human
Antigen E-Selectin/CD62E
Synonyms SELE, ELAM1, ESEL, LECAM2
Accession P16581
Amino Acid Sequence

Trp22-Pro556, with C-terminal 10*His

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 80-92kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Evan Ales.The biology of E-selectinligands in leukemogenesis. Adv Cancer Res. 2023;157:229-250

Background

Trp22-Pro556, with C-terminal 10*His

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGSGGGSHHHHHHHHHH

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 84965120781

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
CurvvyMermaid
Dallas, US
★★★★★ 5
Clear Skin Staple—Gentle Yet Effective and Pairs Perfectly with My Favorite Facial Pads
Style: Blemish Clearing Toner, Size: 12 Fl Oz (Pack of 1)
This toner is my daily go-to for keeping my face in check. It’s gentle on my skin but packs a punch when it comes to keeping my sensitive skin clear and fresh. I use it every morning and night, and my skin has never looked more balanced. It doesn’t sting or dry me out, and it layers beautifully with my other products. Total game changer. I use Thayers Blemish Clearing Toner with the ForPro XL Facial Pads and the combo is perfection. The toner glides on smoothly, and the pads help distribute it evenly without soaking up too much product. My skin feels clean, refreshed, and noticeably clearer. If you’re looking for a refreshing, non-harsh toner to add to your routine that’s simple and effective, this duo is it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2025
L
Verified Purchase
Ladetra Green
Phoenix, US
★★★★★ 5
Gentle, yet very effective
Style: Blemish Clearing Toner, Size: 12 Fl Oz (Pack of 1)
I've used multiple exfoliating toners in the past but none were as effective as this one. I have been using it for 3 days now along with the La Roche-Posay Toleriane Purifying Foaming cleanser and it's cleared the whiteheads on my chin quite a bit and made my face feel and look smooth. Will continue to repurchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
K
Verified Purchase
Katie W
Louisville, US
★★★★★ 5
Finally Something That Works For Me
Style: Blemish Clearing Toner, Size: 12 Fl Oz (Pack of 1)
Imma be honest - I haven’t had great skin for over 30 years. I feel like like there’s always :something: that makes me resort to only being comfortable wearing make-up any day I have to see people / leave the house. But, I started using Thayers in October 2025 (I created my own “Thayers system”: salicylic toner, salicylic pads, and - at times - the stuff in the little dropper bottle) and I can honestly say that :finally: something is working for my skin! I have tried everything! But Thayers is it for me these days. Thank you!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
H
Verified Purchase
Heather
Omaha, US
★★★★★ 5
Awesome!
Style: Blemish Clearing Toner, Size: 12 Fl Oz (Pack of 1)
Love this product! I've used witch hazel for a long time as a toner and to help keep acne under control. Thayer's is the brand I've always used and loved. This one is specific for acne and blemishes, so I thought I'd give this blend a try. There is a slight fruit loop smell (it fades quickly!) and I feel like it's slightly sticky (which is not how plain witch hazel feels) but that also goes away as it dries. I use this anywhere on my face, but especially where there are blemishes and acne. It works well, and doesn't seem to adversely react with my rosacea , which is a plus! I let it air dry, then apply my favorite moisturizer. Results come quickly, and I love how clean and fresh and skin feels!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
R
Verified Purchase
Ragamuffin
West Palm Beach, US
★★★★★ 5
Great Toner!
Style: Blemish Clearing Toner, Size: 12 Fl Oz (Pack of 1)
I have both rosacea and acne. I use this to control my acne breakouts, and it never makes my rosacea flare up. It’s really good toner & I highly recommend it. It has never made me have any sort of rash/breakout/reaction.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026

recommand products