SKU: 85108515806

GCGR His Tag Protein, Human

Sale price$612.00 Regular price$680.00
Save 10%

Pay in installments of $170.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GCGR His Tag Protein, HumanProduct Specification Species Human Accession P47871 1 Amino Acid Sequence Ala26 Lys136, with C terminal 8*His AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK GGGSHHHHHHHH Expression System HEK293 Molecular Weight 33 43 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Accession P47871-1
Amino Acid Sequence

Ala26-Lys136, with C-terminal 8*His AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK GGGSHHHHHHHH

Expression System HEK293
Molecular Weight

33-43 kDa(Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

The glucagon receptor (GCGR) is a Class B GPCR that has an important role in maintenance of glucose homeostasis and, as such, is considered to be a valuable target for the treatment of diabetes. The GCGR is widely expressed and can be found in the liver, adipose tissue, heart, kidney, pancreatic islets, stomach, small intestine, thyroid, and skeletal muscle. The GCGR is coupled to the activation of adenylate cyclase via Gs, with concomitant rise in cellular cyclic AMP levels and activation of protein kinase A (PKA). GCGR mRNA has been detected in islets. In vitro/ex vivo studies suggest that glucagon potentiates insulin secretion from isolated islets, although the potency is considerably less than that of the insulin secretagogue GLP-1. Mutations of the GCGR gene are associated with congenital noninsulin-dependent diabetes, and inhibition of GCGR in vivo lowers blood glucose and improves glucose tolerance in obese diabetic mice.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 85108515806

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Chris
Battle Creek, US
★★★★★ 4
Great Pillow! Could use some improvements
We really like this pillow! It is a good firmness, and helps fill the gap that is often between our headboard and mattress. Only complain is that almost all of the buttons have fallen off. We have had this for about 2 months. You also can’t take the cover off of it to clean, which would be a nice feature.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2026
G
Verified Purchase
ginnygingin
San Leandro, US
★★★★★ 5
Pretty, but very practical.
Size: Full, Color: Mint Green
The color was exactly what I expected from the photo. It arrived in an unbelievably small package, but expanded quickly once I opened the bag. I waited the recommended 24 hours to be sure it was done. I am pleased that the length is a perfect fit, and I like that it comes up to the back of my neck when I'm sitting in bed. It is a bit softer than I originally imagined, but not so soft that I feel like I'm sinking through it. It's very pleasantly supportive. The fabric is like a soft ribbed corduroy with piping along the outer seam. It looks nice. Both ends have a pocket that is barely noticeable, but is the perfect size to keep your phone close by. I'm temporarily homebound and spending a lot of time sitting in bed, so I'm very glad I invested in this pillow for comfort and convenience. If you ever have trouble with pillows working their way under the edge of the headboard, and into the dusty space between the headboard and the wall, consider this problem solved.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2026
G
Verified Purchase
Grace Mannino
Houston, US
★★★★★ 5
Measure your bed and space, I did and ordered the perfect fit!
Size: Queen, Color: Navy
Love this wedge pillow. I bought it for our boat stateroom bed. It fits perfectly as beds on a boat are always odd sizes. It is very comfortable allows me to sit up in bed to read. Also keeps our bed pillows from sliding back. Good quality, color and size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
V
Verified Purchase
Vahri
Omaha, US
★★★★★ 4
Comfy, Supportive, and Great for Lounging in Bed
This wedge-style headboard pillow has made sitting up in bed much more comfortable. The shape offers full upper-back support, with just the right amount of firmness to keep you propped upright without feeling stiff. It’s especially helpful for reading or watching shows in bed, and it stays in place well against a flat headboard. The purple color is rich and vibrant in person, and the removable cover is soft to the touch with a smooth finish. We really appreciated that the cover zips off easily and can be machine washed—it held its shape and color after laundering. The pillow also has a nice weight to it, so it doesn’t feel flimsy or slide down easily. This is a great addition for anyone who likes spending time sitting up in bed, whether for reading, working, or relaxing. It also doubles nicely as a decorative accent when the bed is made. The quality feels solid, and the size works well across the width of a queen bed without overwhelming the space. Id say it is ok for the price. It does retain warmth though
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 1, 2025
J
Verified Purchase
Jace K.
Carnegie, US
★★★★★ 5
Thick, Supportive, and Cozy for Reading or Nursing
Size: Full, Color: Olive Green
This wedge pillow has been a great fit on my daughter’s bed. It’s super soft and cozy, and at the same time offers great support for sitting up in bed. The pillow is nice and thick, so you don’t sink into it — perfect for reading, studying, or lounging without needing multiple regular pillows. I tried it out myself and was surprised at how well it also works as support while nursing an infant. It props you up at just the right angle and feels stable without shifting around. The removable, washable cover is a big plus, and the olive green color is subtle yet stylish. I’m impressed enough that I’ll either be purchasing one for myself soon or adding it to my Christmas list.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 22, 2025

recommand products