SKU: 2052608965

Human PAPP-A, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PAPP-A, His TagProduct Specification Species Human Synonyms Pappalysin 1, Insulin like growth factor dependent IGF binding protein 4 protease (IGF dependent IGFBP 4 protease; IGFBP 4ase) Accession Q13219 Amino Acid Sequence Protein sequence(Q13219, Pro1200 Gly1627, with C 10*His)

Product Specification


Species Human
Synonyms Pappalysin-1, Insulin-like growth factor-dependent IGF-binding protein 4 protease (IGF-dependent IGFBP-4 protease; IGFBP-4ase)
Accession Q13219
Amino Acid Sequence

Protein sequence(Q13219, Pro1200-Gly1627, with C-10*His)


PAEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQTGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 48.8kDa Actual: 65kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Pappalysin-1, also known as pregnancy-associated plasma protein A, and insulin-like growth factor binding protein-4 protease is a protein encoded by the PAPPA gene in humans. PAPPA is a secreted protease whose main substrate is insulin-like growth factor binding proteins. Pappalysin-1 is also used in screening tests for Down syndrome.PAPPA's proteolytic function is activated upon collagen binding. It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses (fetuses with an abnormal number of chromosomes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2052608965

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LakeOfJudea
Chelsea, US
★★★★★ 3
Busted spring on one side....
Color: Black, Size: 28-70"W x 48-120"H (Pack of 1), Color: Black, Size: 28-70"W x 48-120"H (Pack of 1)
I would have given it five stars except for the fact that 1) the instructions that come with it are miserable so you will definitely want to refer to the photos they have in the advertisement here, and 2) it appears that one of the vertical poles has a busted spring and I literally had to stuff some socks underneath it to make it hold. Definitely an eyesore, so I'm not thrilled about that. With that being said, I'm in an apartment and I don't want to drill in the walls to hang a curtain rod. My sliding glass doors have a track that I was able to get brackets that fit over the track to hold a pole, but I had one window that I could not do that with. I thought this would be an interesting way to hang curtains without doing damage. I considered those sticky tape curtain rod holders, but I was reading a lot of bad reviews about them not holding or them taking the paint off upon removal. I figured this was the better option and it gave the room some nice aesthetics because my furniture is farmhouse white wood with black iron accents, so this blended really well with the aesthetics of the room. I know that most people who did reviews used this product as its advertised to be a room divider for privacy... So I figured this is a nice way to review using this product in a different way. I just really can't stand window blinds, as they look so commercial and industrial to me... I needed a way to make the space seem more homey. While this is working fine for me, the reality is I have white lace curtains, which don't weigh much. I don't know that I could recommend this product, even though it says it can support a bit of weight, with curtains that are too heavy. Some of that, in part, is due to the fact that one of my springs is broken so it's not very stable as it is. However, even if I was not having the issue with the spring being busted on one side, I still don't think this would be good with heavy curtains (especially if you like opening your curtains frequently). It did come with curtain hooks if you have the kind of curtains that allow you to use hooks to hang them. I do not. My curtains just slide onto the pole. If they were the type that could be put up with hooks then opening and closing them would probably be easier and maybe not as big of a deal as it is for me with the type of curtains I have. I cannot comment on longevity as I just installed it today... If anything changes I will try to remember to come back and modify this review.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 6, 2025
A
Verified Purchase
Autumm Caines
Carnegie, US
★★★★★ 5
Easy setup works well
Color: Black, Size: 28-70"W x 48-120"H (Pack of 1)
I love these! Have bought two so far. Easy set up and no damage to walls. Room divider or window curtains. Works great!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 6, 2026
M
Verified Purchase
Madison R.
Pawtucket, US
★★★★★ 5
Best no-show socks ever!
Size: 6-10, Color: Black
If you're tired of wearing socks that slip off and show in your sneakers, then you need to try these amazing socks! They are designed to stay in place, even after being active all day. They are incredibly soft and comfortable, and they are truly no-show, so you won't see them at all. I've been using these socks for years and have never had any issues. In fact, I love them so much that I've bought multiple packs, and my family members have started using them too. Don't waste any more time with those annoying socks that slip off and show - give these a try and you won't be disappointed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2024
K
Verified Purchase
Krissy
Omaha, US
★★★★★ 5
The best
Size: 9-11, Color: Black
Seriously the best non slip low cut socks you can find. They stay in place all day and I love the fabric. They are thin which I prefer. These are really the only socks I wear.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
C
Verified Purchase
Cassie Huerta
Bozeman, US
★★★★★ 5
Great socks for the price!
Size: 6-10, Color: Black, Size: 6-10, Color: Black
I love these socks, they are perfect no shows but the material is thick enough for toes not too go thru. The grip is perfect and keeps the sock in place all day. I would definitely order true to size as the fit was perfect. I was surprised to find these socks at the price I did, especially when I got the socks in both black and white.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2025

recommand products