SKU: 89376132993

Human BST2 , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human BST2 , His tagProduct Specification Species Human Synonyms HM1. 24 antigen, Tetherin, CD317 Accession Q10589 Amino Acid Sequence Protein sequence(Q10589, Asn49 Ser161, with C 10*His) NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 14. 3kDa Actual: 18 25kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms HM1.24 antigen, Tetherin, CD317
Accession Q10589
Amino Acid Sequence

Protein sequence(Q10589, Asn49-Ser161, with C-10*His)

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:14.3kDa Actual:18-25kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Tetherin, also known as bone marrow stromal antigen 2, is a lipid raft associated protein that in humans is encoded by the BST2 gene. In addition, tetherin has been designated as CD317 (cluster of differentiation 317). This protein is constitutively expressed in mature B cells, plasma cells and plasmacytoid dendritic cells, and in many other cells, it is only expressed as a response to stimuli from IFN pathway.Tetherin has been shown as a Type-I-IFN biomarker using flow cytometry, B cell Tetherin was used as a Cell-Specific Assay for Response to Type I Interferon Predicts Clinical Features and Flares in Systemic Lupus Erythematosus. Tetherin has also been predicted to be involved in cell adhesion and cell migration. Recently it has, also, been identified as the protein that help stabilize lipid rafts by joining nearby lipid rafts to form a cluster. For some viruses, such as Dengue virus, tetherin inhibits the budding of virions as well as cell-to-cell transmission of the virus. For human cytomegalovirus (HCMV), tetherin promotes entry of the virus, especially during cell differentiation. It has also been shown that tetherin is incorporated into newly formed virions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 89376132993

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
D. Porrey
Battle Creek, US
★★★★★ 5
Very Different, But Works Well
This is built much different than the others. It has a foam seal around the edges. The filter portion is standard, but the carbon activated material is a setoff beads suspended between a screen a honeycomb structure. There is air freshener built-in to help with the smell in the car. Fits well in my 2015 RAV4. Just as easy to install as any other filter. The price is on the high side so with this one I am hoping to get at least one year of use from it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 25, 2025
P
Placeholder
Los Angeles, US
★★★★★ 4
Well-Made Carbon Cabin FIlter
I love the honeycomb carbon filter on this cabin filter. It looks like it will do an excellent job cleaning the air in my car. It came in a cardboard box and was easy to install and fit my Toyota well. I would have appreciated some arrows on it, like other filters come with, to let me know I was inserting it correctly. I just followed the example of the one already in my car. If you accidentally take that one out first, you may not remember which side goes where. So, my improvement would be arrows on the filter itself. Otherwise, the airflow seems great, it functions well and seems to be a great quality!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 14, 2025
A
Amazon Customer
Boise, US
★★★★★ 5
Use activated carbon to clean the air naturally!
This is a serious air filter with activated carbon inside of it and I'm here for it. I use little activated carbon bags in my car already as an air freshener because I hate those fake chemical scents from the little trees or from the car wash. The chemicals in those fake scents give me migraines. I absolutely love the idea of putting the active carbon in the cabin air filter itself to clean the air. This fits prefecture in my 2017 toyota prius v. It was just a easy to install as any purge cabin air filter. The hardest part is opening all the parts of the glove box to get the old one out. This filter seems sturdier than my last one and it's a good value for the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 11, 2025
L
Lucky1334
Houston, US
★★★★★ 5
Perfect fit for 2016 Corolla!
Fit's my 2016 Corolla perfect. Has a sturdy frame. Other name brand ones I have purchased before don't have the sturdy frame and squish up. This comes with tiny fragrant beads on the top part and has a light fresh scent when the air is on. Very happy so far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 8, 2025
M
Verified Purchase
Mr Frosty
Los Angeles, US
★★★★★ 5
Good fit, good value
Style: CF12436 Classic, Style: CF12436 Classic
Purchased this filter for my 2023 Outback. First off changing the cabin filter on this model Subaru is amazingly easy and can be done with no tools and no more then 5 minutes. Pictures posted show packaging, the paper "Blue" filter side, the "Black" charcoal side and the foam outer edge. The filter is well made and is very sturdy as the outer shell is plastic vs. other paper filters that are more flexible. Holding the filter in your hand and giving it a slite shake you can hear the activated charcoal within it. After installing the filter I had a few trips in the car, did I notice any difference in the air quality coming into the cabin....... no. But does this mean its not working? also no. What I can say is the filter fit snug and left no gaps, and with the plastic surroundings and foam in sure the filter will not be letting anything get by as it passes through the system. All and all this filter is well made and sturdy, and seems to be a good value with other paper only filters being about the same price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026

recommand products