SKU: 895112236

Cholera Toxin B subunit (CTB)

Sale price$126.00 Regular price$140.00
Save 10%

Pay in installments of $35.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cholera Toxin B subunit (CTB)Product Specification Synonyms CHOLERA TOXIN B SUBUNITCTB Cholera Toxin B subunitCTxBCholeragenoid Accession P01556 Amino Acid Sequence MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN Expression System E. coli Molecular Weight 11. 8kDa(Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <0. 2EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris, 100mM

Product Specification


Synonyms CHOLERA TOXIN B SUBUNIT、CTB、 Cholera Toxin B subunit、CTxB、Choleragenoid
Accession P01556
Amino Acid Sequence

MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN

Expression System E.coli
Molecular Weight

11.8kDa(Reducing)

Purity >95% by SDS-PAGE & RP-HPLC
Endotoxin <0.2EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH9.0
Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Cholera toxin (CTB)belongs to the AB5 –subunit family oftoxins.The native hexameric protein has a molecular mass of ~85 kDa and contains two subunits. It consists of a single A subunit (~27.2 kDa), responsible for the ADP-ribosylation activity, and five B subunits(~11.6 kDa each), which are arranged as a pentameric ring with an apparent 5-fold symmetry and are associated with the cell surface receptor binding and subsequent internalization (transmembrane transport)of the enzymatic component.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 895112236

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Robert Bollman
Natrona Heights, US
★★★★★ 5
Very helpful
Good plan to have.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026
A
Verified Purchase
Amazon Customer
Boise, US
★★★★★ 5
Asurion worked as intended.
After three years, my monitor failed. Asurion paid to send it to a repair center. I didn't save the box the monitor came in, and paid $23 to have it packaged up. They kept me informed of the various steps, such as en route, arrived, testing, and repair started. They discovered it could not economically be repaired and refunded my purchase price. The entire process from me telling them it was broken until the refund took 5 days. I am well satisfied with the service.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 31, 2025
G
Verified Purchase
GrizzDean
Battle Creek, US
★★★★★ 5
Excellent, prompt, zero hassle protection
I purchased a nice 3D printer for my grandson. He was thrilled and he and his dad used it frequently. The printer developed a serious problem but, thankfully, I had also purchased a three-year protection plan with Asurion. We shipped the printer to Asurion via UPS since they readily agreed to repair it or refund the purchase price. After only a few days, Asurion emailed me that the printer was not repairable. They sent me a link that enabled me to send the full purchase price to my Amazon account. I used it to purchase another printer. I am happy and my grandson is thrilled! I should add that the extended protection did not cover sales tax, nor did it cover shipping cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026
A
Verified Purchase
Alexander
Houston, US
★★★★★ 5
Strongly recommend
I recently used the services of this company, and I was completely satisfied. They work very professionally: whenever I reached out, they quickly resolved any issues. I strongly recommend that anyone who purchases electronic devices register their product with this insurance. It is truly reliable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026
A
Verified Purchase
AC_TX
Pawtucket, US
★★★★★ 5
Cheap Insurance - Easy Claims Process!
I bought this warranty plan for a Dell monitor about 3.5 years ago. About a month ago, it started to give me some intermittent problems (very fast flickering & image retention). I tried everything I could to troubleshoot the issue, but it just kept coming back. I had some issues with logging into my Asurion account because I used an EDU email, which I no longer have access to. I sent a message to Asurion here on Amazon and they sent me my plan details and everything I needed to make a claim within 24 hrs. Once I was able to log into my account online, the claims process couldn't be faster/easier. I used the chat function and provided the rep with the issues I was having with my monitor. The rep immediately emailed me a pre-paid UPS label to send my monitor to one of their repair facilities. I got another email when my monitor was received stating that repairs could take up to 5 business days. However, the very next day I got another email stating that my monitor couldn't be repaired and they would be reimbursing me the full purchase price. I received another email with an Amazon gift card for the full price of the monitor within minutes. This is my first experience with Asurion and I'm very impressed. The customer service is top notch. If I ever buy another expensive electronic item from Amazon, I'm definitely buying an extended warranty from Asurion.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2025

recommand products