SKU: 89728326273

Human IL-1beta, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-1beta, His tagProduct Specification Species Human Synonyms Catabolin Accession P01584 Amino Acid Sequence Protein sequence (P01584, Ala117 Ser269, with C 10*His) APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 19 kDa Observed MW: 20 kDa Purity 90% by SDS PAGE Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms Catabolin
Accession P01584
Amino Acid Sequence

Protein sequence (P01584, Ala117-Ser269, with C-10*His) APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19 kDa Observed MW: 20 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin-1 beta (IL-1β) is a proinflammatory cytokine that is mainly produced by monocytes and activated macrophages as a proprotein. Inflammatory responses are mediated by IL-1β in T cells, natural killer cells (NK cells) and B cells. It induces the production of pro-inflammatory cytokines (IL-2, IL-3, IL-6) as well as interferons. Furthermore, IL-1β modulates the secretion of cytokines by various subsets of human DCs.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 89728326273

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
AW
Los Angeles, US
★★★★★ 5
Great suit!
Color: Black, Size: Small
Great suit! Suit is well made for the price. Very comfortable, nice material and could be worn for any occasion no matter the time of year. We ordered according to the size chart and fit great! Would be easy to do a little tailoring if needed tho. Came in quick and is exactly what we needed. Will be ordering other colors for the future!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
K
Verified Purchase
Ken
Omaha, US
★★★★★ 5
XS great fit very pleased!! 5’8”-5’9” 140 lbs
Color: Dark Grey, Size: X-Small
My son is wearing this to prom he is about 5’8”-5’9” all muscle 140 lbs and I had to order an xs in grey. The small jacket was good but the pants were to big/baggy. The quality is nice and wow the fit is great!!! So pleased. I will try to update later with a picture
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
J
Verified Purchase
Joe
New York, US
★★★★★ 5
Just an unbelievable purchase and strongly recommend
Color: Black, Size: Medium
Unbelievable! One of the BEST purchases I made. Fits perfectly, wasn’t wrinkled at all. In fact, I don’t need to take it to the cleaners to be pressed. Class all the way. Well made, elegant, fabric was perfect as it was not too thin. Compared to tuxedos in the store and this was exactly the same. Only difference is this suit was $150 less!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
T
Verified Purchase
Tiffany Davis
San Leandro, US
★★★★★ 4
Good. Decent quality.
Color: Black, Size: Small
The quality is good, especially for the price. I didn’t like that the wrist buttons were non functional. We bought cuffs that he couldn’t use. It looks nice. The size is a little big for my son, but that was kind of expected. I was hoping we would get lucky and that wouldn’t be the case but I couldn’t find any suites in a smaller size that would arrive on time. He is 5’7, 120-125 pounds. It was mostly in the shoulders that it looks big. He is thin. The arm length fit him but he does have long arms. The pants fit with a little looseness. His jeans size at American eagle is 28/36, but he can fit slightly bigger with a belt. The pants were good but the vest and jacket were a little big. They’re just slightly long and jacket is big in the shoulders. We got a size small.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
S
Verified Purchase
Santino Gaeft
Massapequa, US
★★★★★ 5
QUALITY AND COMPORTABLE FITTING IN LOWER PRICE...
Color: Navy, Size: Large
WOW! this suit really true to its sizes description... I ordered in a different company before this, but I have to return it TWICE because of wrong size fittings... Finally, this beautifully tailored suit timely arrived before my son's wedding reception, and we are ready to celebrate!!! Thank you and might order some different colors in the future... I wonder if they can make the pants in higher waist and straight cut or wider for the legs in the future as an option... Just a thought since slim fit pants are slowly outdating...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026

recommand products