SKU: 90187707091

Canis lupus familiaris CD64, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Canis lupus familiaris CD64, His tagProduct Specification Species Canis lupus familiaris Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI Accession Q7YQJ5 Amino Acid Sequence Protein sequence (Q7YQJ5, Gln16 Pro288, with C 10*His)

Product Specification


Species Canis lupus familiaris
Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI
Accession Q7YQJ5
Amino Acid Sequence

Protein sequence (Q7YQJ5, Gln16-Pro288, with C-10*His) QTDPVKAVITLQPPWVSVFQEESVTLWCEGPHLPGDSSTQWFLNGTATQTLTPRYRIAAASVNDNGEYRCQTGLSVLSDPIQLGIHRDWLILQVSGRVFTEGEPLTLRCHGWNNKLVYNVLFYQNGTVLKFSPQNSEFTILKTTLHHNGIYHCSAMGKHRYESAGVSITIKELFPAPVLKASLSSPILEGHVVNLSCETKLLLQRPGLQLYFSFYMGSKTLLSRNTSSEYQILTAKKEDSGLYWCEATTEDGNVVKRSPELELQVVGPQTLTPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 32.2 kDaObserved MW: 33, 40, 45 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD64 (Cluster of Differentiation 64) is a type of integral membrane glycoprotein known as an Fc receptor that binds monomeric IgG-type antibodies with high affinity. It is more commonly known as Fc-gamma receptor 1 (FcγRI). After binding IgG, CD64 interacts with an accessory chain known as the common γ chain (γ chain), which possesses an ITAM motif that is necessary for triggering cellular activation. Structurally CD64 is composed of a signal peptide that allows its transport to the surface of a cell, three extracellular immunoglobulin domains of the C2-type that it uses to bind antibody, a hydrophobic transmembrane domain, and a short cytoplasmic tail. CD64 is constitutively found on only macrophages and monocytes, but treatment of polymorphonuclear leukocytes with cytokines like IFNγ and G-CSF can induce CD64 expression on these cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90187707091

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
SimplyJacquelin
Massapequa, US
★★★★★ 5
Exactly What I Needed For My GSD Puppy!
Style: Tuggi Hide, Style: Tuggi Hide
Pros: Super durable and sturdy – holds up well to tugging Stretchy bungee handle with comfortable padding Soft material that's gentle on puppy teeth Treat pocket encourages drive and engagement Great for interactive training and building play drive Fun blue color and perfect size for small to medium dogs Excellent for bite interruption and redirection Cons: Treat pocket can be tricky to find at first The Velcro closure could be longer or more secure Not meant to be left out – supervision required Exactly What I Needed to Build Drive in My GSD Puppy! This Coachi Tuggi Hide is exactly what I was searching for to help build drive in my little German Shepherd pup. The fact that I can tuck treats into the pocket and use it for a tug game? Genius. Let’s talk about that stretchy bungee handle – wow. It adds just the right amount of give and makes it easier on both of us during play. Plus, the padded handle is honestly one of my favorite features. I can play longer without discomfort, and the padding is legit comfortable. It’s super sturdy and ridiculously durable. I know I said “durable” like three times, but seriously—it deserves it. It’s also super soft, which is great for a teething puppy. The treat pocket is a great idea, though I will say it took me a minute to find it at first. Once I did, I noticed the handle actually runs deep into the toy. That’s great for strength, but do make sure you get all the treats out before storing. I also love the blue color, and the size is perfect for tugging and engaging a puppy. One small design tweak I’d suggest? Making the treat pocket a little longer or adjusting that hook-and-loop closure—it’s a bit short for how deep the pocket goes. That said, this toy is a total win. It’s a training tool, not a chew toy, so I don’t leave it out unsupervised. When we use it together, it’s pure gold. My puppy loves it, I love it, and our training sessions are so much more fun now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2025
R
Verified Purchase
Roxanne
Lake Worth, US
★★★★★ 5
Good value and quality.
Style: Tuggi Hide
Great for sports dog and building drive. This isn’t a chew toy to let a dog shred. I have big dogs that love to tug, and this has held up to a huge amount of use with high drivey dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
D
Verified Purchase
Dog Trainer
Battle Creek, US
★★★★★ 5
Good quality! Great reward for my search and rescue dogs!
Style: Tuggi Ball
My dogs love this! The bungee makes it easier on my shoulder and my dog enjoys it a lot. Super lightweight which is important for taking it on searches. Holds up to my intense working dog’s tug sessions *note that it is an interactive toy not a chew toy. Probably wouldn’t last long if you just give it to them to play on their own but perfect for a good game of tug
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2024
J
Verified Purchase
Josiah Jackson
Grantham, US
★★★★★ 4
Fun for a short while
Style: Chase & Crinkle, Style: Chase & Crinkle
4 month old GSD puppy loved this toy but it did not last long before getting a whole in the crinkle part. I even limited the amount of play my dog had with it so I could increase the value of the toy to use it for distractions.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
A
Verified Purchase
Alex V.
West Palm Beach, US
★★★★★ 3
Not for low food-drive dogs
Style: Chase & Treat
Not the right toy for us but maybe for others. Seems durable and is on the more affordable side. However, the Velcro is so strong that it’s difficult and/or uncomfortable for our dog to open it. May be better suited for a more food-driven dog.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2025

recommand products