SKU: 90580954575

TNFRSF10B/TRAIL R2 Fc Chimera Protein, Mouse

Sale price$184.50 Regular price$205.00
Save 10%

Pay in installments of $51.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TNFRSF10B/TRAIL R2 Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen TNFRSF10B TRAIL R2 Synonyms TNFRSF10B,TRAILR2,TRAIL R2,CD262,DR5,KILLER,TRICK2,ZTNFR9 Accession Q9QZM4 Amino Acid Sequence Asn53 Ser177, with C terminal Mouse IgG Fc

Product Specification


Species Mouse
Antigen TNFRSF10B/TRAIL R2
Synonyms TNFRSF10B,TRAILR2,TRAIL-R2,CD262,DR5,KILLER,TRICK2,ZTNFR9
Accession Q9QZM4
Amino Acid Sequence

Asn53-Ser177, with C-terminal Mouse IgG Fc NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWASIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 45-60kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Walczak, H. et al. (1997) EMBO J. 16:5386.

Background

TNFRSF10B, also called TRAIL R2 and DR5, is a member of the TNF receptor superfamily.TRAIL-R2 contains two extracellular cysteine-rich repeats, typical for TNF receptor (TNFR) family members, and a cytoplasmic death domain. TNFRSF10B / DR-5 is widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines. Human and mouse TRAIL R2 share 49% amino acid sequence similarity. Some studies have suggested that TNFRSF10B contributes more than TNFRSF10A (TRAIL R1) to TRAIL-induced apoptosis in cancer cells that express both receptors. In addition, agonistic monoclonal antibodies against TNFRSF10B, which can induce apoptosis in the absence of TRAIL, are used for cancer therapies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90580954575

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
BellaGi
Waukegan, US
★★★★★ 5
2 years later and it’s still going!
Color: Cyan NylonFish, Color: Cyan NylonFish
I have 2 dogs, a 6lb chihuahua (Lolli) and an almost 100lb German shepherd/Belgian Malinois (Uzi). Got this for Uzi, however, Lolli had other plans for it. She literally took it out her mouth and ran to hide it. It’s been over a year, closer to 2 and it’s still hanging on. Attached a photo of Lolli…
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
S
Verified Purchase
steven casteel
Los Angeles, US
★★★★★ 5
Best found
Color: Cyan NylonFish
I have a heavy heavy chewer, the only things that has escaped him were items like "kong" solid and rubber but no squeaky. He quickly lost interest in the toy; largely within a week at most and never picks it up again unless really bored. Squeaky toys had a life shelf of a week at best, that is with us taking them away to "preserve" them for longer. So far, this toy, the fish, has been the longest surviving squeaky and the longest at keeping his interest. it has received some cosmetic damage, but nothing that would make you remove the toy from his possession and it STILL squeaks.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 20, 2024
C
Verified Purchase
Courtney
Cuba, US
★★★★★ 4
Still holding up to my super-chewer!
Color: Cyan NylonFish, Color: Cyan NylonFish
It's a very good product. I would recommend this toy for a heavy chewing dog. My main reasons it's not 5 stars, it's HEAVY and the eyes peeled right off. My pup really likes to throw his toys around, this thing sounds like a cannon ball that's going to go through our floor! He also tries to destroy everything so he was chewing on the eyes and he would have definitely eaten them if I wasn't paying attention. It's not a horrible thing but I obviously don't want him to eat non food things. My dog also likes the squeaker in it, but it's difficult for me to get it to squeak. That's not a big deal though just thought I should mention it. Overall especially for the price, it's a good sturdy product that's cute and it's still holding up. He's chewed parts of the softer areas off a bit, but the rest is very hard so he hasn't made much of a dent. It's also about as big as his head, so he's pretty happy with it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2025
S
Verified Purchase
Sandra Black
Omaha, US
★★★★★ 5
Your dog will.love this banana
Color: Banana
My dog loves this, plays with it constantly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
A
Verified Purchase
Amazon Customer
Fort Morgan, US
★★★★★ 5
Great toy for your dogs!
Color: Banana
This was ordered to replace a beloved squeaky toy of my dogs and this toy is even better than the original! Very durable and a great price! It’s such a fun toy for our dogs!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2025

recommand products