SKU: 90784187155

Human papillomavirus type 16 E7, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human papillomavirus type 16 E7, his tagProduct Specification Species Human papillomavirus type 16 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98, with C 10*His) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 12. 7 kDa Observed MW: 16, 20 kDa Purity 90% by SDS PAGE Endotoxin <1EU g Tag His Tag, with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human papillomavirus type 16
Accession P03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98, with C-10*His) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.7 kDa Observed MW: 16, 20 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag, with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins, and only the high-risk HPV E6 proteins form detectable complexes with p53 in vitro.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90784187155

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Andrea
Fort Morgan, US
★★★★★ 5
Great for the storm shelter!
Style: Updated 3.46in Magnet L Red Hooks 2PCS, Style: Updated 3.46in Magnet L Red Hooks 2PCS
In our storm shelter we had some lights that we tried to hang up, multiple times, with no luck! Then I found these garage hooks. They are overkill for the lights, but I’m so happy that we now have lighting in the storm shelter. I could think of so many other uses for these. They strength of the magnets is awesome!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
K
KindaPicky
Los Angeles, US
★★★★★ 4
Magnet is super strong but hooks are not adjustable
Style: Updated 3.46in Magnet L Red Hooks 2PCS, Style: Updated 3.46in Magnet L Red Hooks 2PCS
I ordered this set of Mutuactor magnetic hooks because I was tired of thinking I had things organized and then finding previously hung magnets have slid down the wall. It was a first for me to have to assemble a magnetic hook. This was made slightly more difficult by requiring a wrench. So many items these days arrive with a disposable little hex wrench or whatever is needed for assembly. Not in this case. Maybe the manufacturer assumes if you are spending $15 per magnet to hang your tools you have a wrench handy. Anyway, I got my wrench and found no instructions. I know from life that the order is bolt-washer-lock washer-nut. The next question arose when I found one bolt and several holes... hmmmm. It looks like they wanted to provide the option to screw the hooks directly to the wall. I am not sure the average person would pay that price just for a hook, though. I chose a hole and it seems to be the right one. The good news is I was quickly in business. Soon one magnet was snatched by my husband for his rolling tool cart. He hung his (very heavy) Sawzall and the magnet never moved. He liked the rubber coating that protects his tools. I chose to take advantage of the amazing grip of this thing to hang my most used (and also very heavy) all-clad pan from the side of my fridge. The refrigerator had some sort of glossy powder coat and magnets hold well if you try to pull them straight off but end up sliding down anyway. This is where I came to appreciate the rubber shoe of this magnet. It protects my fridge but I think it plays an essential part in the grip strength of the magnet. I can not slide it around - I need to use two hands to pull it off then place it in another position. To give a magnet strength example I had one magnetic hook on my desk as I was writing this review. My nearby desk-size scotch tape dispenser came sliding over and the magnet grabbed it. I was able to lift the tape dispense just by the magnet grabbing the little piece of metal serrated teeth that cut the tape. There is no other metal in my dispenser. That's it! In summary, four stars because it REALLY grips and holds a lot of weight. Minus a star because I do think they are a little expensive, they required assembly without tools or instructions, and the hooks themselves are not adjustable. I have some similar magnetic hooks and you can move the two prongs apart or together depending on what your tool size is. These prongs are strong and firm and are not moving and this cuts down of the number of uses a little bit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
F
Francisco P.
New York, US
★★★★★ 5
Develop some quality, worth-while hangups!
Style: Updated 3.46in Magnet L Red Hooks 2PCS, Style: Updated 3.46in Magnet L Red Hooks 2PCS
Organization is key for any shop space. This goes double for smaller shops. If you look around and DON'T see something that could benefit from getting off the floor and onto a peg or hook, I applaud you! For the rest of us, where can we get started? Here you go. These hooks come two in a package. The quality of these are easy to see. The powder coating is very nice as powder coating is more durable than paint. The orange plastic coating on the hooks feels thick and durable. Assembly is easy. There's a threaded post sticking out of the black rubber coated magnet "puck" that you insert into a opening on the hook and secure with washers and a nut. I like that they included both a washer and locking washer. If it matters, I always stack the fastener in the following order: washer, locking washer, then nut. Using a 14mm socket, I was done in no time. How's much will these hooks hold? The magnetic power on these hooks feels substantial. When I slowly approached the side of my metal toolbox, the magnet made an audible snap when it magnetized to the side. It felt strong! The bend at the base of the hook added stability pressing against the toolbox but didn't mark the surface since it was covered by plastic. It held my heavy 50a extension cable and the other hook held both my 25' and 50' pressure washer hoses. Neither moved at all and felt very secure. Whether your shop is your garage or basement, making the most of your space makes a difference and these can help. These are very strong and hold items safely. I'm very happy having these around and will be getting more. If you have a metal surface that you can attach hooks, give these a try. It's a quality solution!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
B
Verified Purchase
breezob
Whiting, US
★★★★★ 1
Not strong
Style: Updated 3.46in Magnet L Red Hooks 2PCS
The magnets are not strong enough to hold garden tools!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
H
HAW
Battle Creek, US
★★★★★ 5
Awesome product!!!
Style: Updated 3.46in Magnet L Red Hooks 2PCS, Style: Updated 3.46in Magnet L Red Hooks 2PCS
Wow when they describe these magnets as “super string” they are not joking! Magnets are so strong you must be careful when placing them on your metal cabinet, lest it pinch your finger when the magnet grabs the metal! This is an awesome product. The hooks have a hole in their base that fits over a threaded post / bolt coming out of the center of the magnet and the kit comes with two washers, lock washers, and bolts to attach the hooks to the magnets. Takes about one minute per magnet to assemble. Once on the wall they feel like they will hold a lot of weight though I did not try to test the upper limit. No problem at all holding yard tools and the like. The hooks or arms have a nice rubberized coating and extend about 4.5” out from the wall. At $15 each these seemed a little pricy but wow what a great solution for hanging things on metal walls. They work so well I will be buying more of these! I actually have some other similar very strong round magnets made for a similar purpose … but they do not have the “built-in” hooks like these do and it makes a big difference for the usefulness! Considering all of that I think they are a great value. Item reviewed: MUTUACTOR Updated Super Strong Magnetic Hooks,40lbs, 2-pack
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026

recommand products