Pay in installments of $52.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 9 - Aug 14
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD151 Protein, His tagProduct Specification Species Human Synonyms CD151 antigen, GP27, Membrane glycoprotein SFA 1, Platelet endothelial tetraspan antigen 3 (PETA 3), Tetraspanin 24 (Tspan 24), TSPAN24 Accession P48509 Amino Acid Sequence Protein sequence (P48509, Try115 Arg221, with C His tag) YQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR Expression System HEK293 Molecular Weight Predicted MW: 13. 9 kDa
Product Specification
| Species | Human |
| Synonyms | CD151 antigen, GP27, Membrane glycoprotein SFA-1, Platelet-endothelial tetraspan antigen 3 (PETA-3), Tetraspanin-24 (Tspan-24), TSPAN24 |
| Accession | P48509 |
| Amino Acid Sequence | Protein sequence (P48509, Try115-Arg221, with C-His tag) YQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 13.9 kDa Observed MW: 17-20 kDa |
| Purity | ＞90% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | with C-His tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
CD151 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. CD151 is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Abnormalities in CD151 have been implicated in a form of epidermolysis bullosa.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy