SKU: 91336480782

MOG His Tag Protein, Mouse

Sale price$261.00 Regular price$290.00
Save 10%

Pay in installments of $72.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MOG His Tag Protein, MouseProduct Specification Species Mouse Antigen MOG Synonyms BTN6, BTNL11, MOGIG2, NRCLP7, Myelin oligodendrocyte glycoprotein Accession Q61885 Amino Acid Sequence Gly29 Gly153, with C terminal 8*His GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 19 22kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Antigen MOG
Synonyms BTN6, BTNL11, MOGIG2, NRCLP7, Myelin oligodendrocyte glycoprotein
Accession Q61885
Amino Acid Sequence

Gly29-Gly153, with C-terminal 8*His

GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

19-22kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Reindl, M. et al. (2013) Nat. Rev.Neurol. 9:455.

Background

Myelin oligodendrocyte glycoprotein (MOG) is a transmembrane protein belonging to immunoglobulin superfamily.  Mouse MOG is synthesized with a 28 amino acid (aa) signal sequence, a 128 aa extracellular domain (ECD) containing an Ig-like domain, a 21 aa transmembrane domain, and a 69 aa cytosolic fragment featuring a hydrophobic domain that associates with the cytoplasmic face of the plasma membrane. MOG is expressed exclusively by oligodendrocytes in the central nervous system (CNS) and is localized to the outer layer of the myelin sheath as well as in the oligodendrocyte plasma membrane. This makes MOG a potential target of cellular and humoral immune responses in inflammatory demyelinating diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 91336480782

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Matt S.
Cuba, US
★★★★★ 5
Long lasting
Flavor Name: Bacon, Size: Medium
Great dog toy, long lasting
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
M
Verified Purchase
Marie Phillips
Draper, US
★★★★★ 4
Tough Chewer Approved but Not a Forever Toy
Flavor Name: Original, Size: X-Large
I do like this toy for what it is meant to do. It is definitely built for strong chewers and holds up way better than softer toys that get destroyed in minutes. The texture keeps dogs interested and gives them something to really work on, which helps with boredom and can support dental cleaning through chewing. It is one of those “finally something that lasts a bit” kind of toys for heavy chewers. That said, it is not something you just toss in and forget about forever. Like most hard nylon toys, it will wear down over time and should be checked regularly for rough edges or changes in shape. Some dogs will also go through it faster depending on how intense their chewing style is, so replacement will eventually be needed. Girl, this is one of those “it survives the chaos better than most, but you still need to keep an eye on it” situations.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
C
Verified Purchase
Customer Review
Cuba, US
★★★★★ 5
The Remote Worker's Savior
Flavor Name: Bacon, Size: Medium
If you're like me, trying to balance deadlines and Zoom meetings while your furry co-worker incessantly nudges you for attention, then listen up because I've found the ultimate secret weapon: the Nylabone Chew Dog Toy. Trust me, it's a game-changer that will keep your dog busy and your productivity soaring. Picture this: you're knee-deep in spreadsheets, buried in emails, and your dog is bouncing around like a furry tornado, demanding playtime. Enter the Nylabone Power Chew, the superhero of dog toys that saves the day. Its durability is off the charts, my friends. It can withstand a full day of canine chewing fury, leaving your furniture unscathed and your dog blissfully entertained. But here's where the magic happens. This toy isn't just tough; it's also infused with a bacon flavor that sends your dog's taste buds into a frenzy. It's like having a bacon-scented office right in your home! As your dog sinks their teeth into this baconlicious wonder, their focus shifts from your keyboard to their newfound chewy delight. Suddenly, the tug-of-war with your important documents becomes a distant memory. Now, let's talk about the beauty of this toy's distraction power. With the Nylabone Power Chew in play, your dog becomes engrossed in their chewy mission. They're occupied, happily gnawing away, while you conquer your work tasks like a true champion. It's like having a personal assistant who doesn't interrupt you every five minutes with a squeaky toy demand. But don't be fooled by its functionality; the Nylabone Power Chew brings more than just peace and quiet. It brings laughter and joy to your work-from-home routine. Watching your pup go to town on this bacon-infused wonder is like having a built-in comedy show right in your home office. It's the perfect stress relief during those never-ending conference calls. And let's not forget the Nylabone brand's commitment to quality. This chew toy is built to last, crafted with non-toxic materials that keep your beloved furry friend safe and sound. It's like having a reliable coworker who never lets you down. So, my fellow remote workers, if you're desperate for a productivity boost and a furry coworker who won't pester you all day long, the Nylabone Chew Dog Toy is your secret weapon. It's a dog toy miracle that keeps your pup happily occupied while you conquer the work world. Say goodbye to interruptions and hello to a harmonious work-from-home environment. Trust me, you'll wonder how you ever survived without it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2023
H
Verified Purchase
Hot Rod
Waukegan, US
★★★★★ 5
Clean teeth as well!!
Flavor Name: Bacon & Chicken, Size: Small
If your dog is a chewer or just bored, these bones are amazing. All of my dogs love and have loved Nylabones. I consider them a must to give your dog as an outlet to chew when bored or when in need of stimulation. Replace as necessary. I always have a pack on standby.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
D
Verified Purchase
D. Kitchens
Bozeman, US
★★★★★ 3
Not for chewers
Flavor Name: Bacon & Chicken, Size: Small
My dog liked these okay. He was able to chew little pieces off though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026

recommand products