SKU: 93063035635

S100B, Human

Sale price$148.50 Regular price$165.00
Save 10%

Pay in installments of $41.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

S100B, HumanProduct Specification Species Human Accession P04271 Amino Acid Sequence Ser2 Glu92, with N terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Expression System E. coli Molecular Weight 11 12 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <2EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized Powder Reconstitution Reconstitute at less than 1 mg mL according to the

Product Specification


Species Human
Accession P04271
Amino Acid Sequence Ser2-Glu92, with N-terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Expression System E.coli
Molecular Weight 11-12 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

S100B is a small calcium-binding protein in the neuronal system, and belongs to the S100 family. S100B proteins are a family of 25 homologous intracellular calcium-binding proteins characterized by EF hand motifs, low molecular weights (9–13 kDa), ability to form homodimers, heterodimers and oligomeric assemblies, and are characterized by tissue and cell-specific expression.  They are solely present in vertebrates. S100B protein is mainly expressed in the neuronal system such as astrocytes, maturing oligodendrocytes, dendritic cells, and Schwann cells. However, some other cells outside the brain, like kidney epithelial cells, ependymocytes, chondrocytes, adipocytes, and melanocytes, can also express S100B protein.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93063035635

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michelle
Pawtucket, US
★★★★★ 4
Pieces chewed off
Color: white & green
My Aussiedoodle loves it. I throw it down the hallway, it bounces crazy, and he chases it. The only complaint is that he can't chew much of the ball part. So now I have to have it put away and brought out for special playtime.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
J
Verified Purchase
JohnMichael Rodriguez
Massapequa, US
★★★★★ 5
Finally, a toy my dog hasn’t murdered
If your dog destroys toys like it’s their full-time job, this stick is the boss-level challenge they didn’t see coming. I gave it to my power-chewer (a pit mix with jaws of steel), and after a week of gnawing, tossing, and dramatic tug-of-war battles, it’s still intact. Not even a dent. I think it might be made of space-grade rubber or the same stuff they use in black boxes. It’s got a good weight to it — heavy enough to feel solid, light enough to toss without pulling a shoulder. No squeaker, no fluff, no sad stuffing guts all over the living room. Just pure chewable glory. Pros: • Actually indestructible (or close enough) • Great for aggressive chewers • No squeaker = peace and quiet • Easy to clean and doesn’t smell weird • Doubles as a fetch toy and chew stick Minor feedback: It’s a bit heavy for small dogs, and it doesn’t bounce or squeak — but if your dog’s into serious chewing, they won’t care. Also, don’t drop it on your foot. Trust me. Final thoughts: This toy is the Chuck Norris of dog sticks. If your pup has shredded everything else, give this a shot. It might just survive — and so might your sanity.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2025
M
Verified Purchase
Matt
Fort Morgan, US
★★★★★ 5
Durable
If you have an aggressive chewer this will hold up for about a month. After about a month of daily use my police k9 will get the ends off. Is it completely indestructible no, does it hold up better then any other toy he’s had absolutely. When you have a dog with super high toy drive you understand nothing is indestructible but I will say a month for a toy to last with my dog is great and I accept the fact I just have to buy new toys monthly. For reference my dog will destroy a Kong in about half the time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
D
Verified Purchase
Dana
Louisville, US
★★★★★ 5
GREAT DURABILITY FOR MY XL SUPER CHEWER !
My dog LOVESSSSS this toy. It’s definitely one of her favorites! I have a Pit-Mastiff mix and she loves to chew toys, but her breed also means she’s got an outrageous amount of strength in those jaws, making it hard to find toys that can last without getting torn up super easily. We typically buy Kong “Super Chewer” toys and this has held up better than those! We’ve had it a good few months and it’s super durable. She gnaws on this thing every day for a good bit of time, and it doesn’t have any weak spots, holes, chunks missing, NOTHING, except a few dimples. It’s firm but also has give to it that (I think) really provides a good chewing option. It’s got enough weight and give to it that I can throw it for her and it’ll bounce without flying around crazy like some toys. The toy itself is not super cute, but my dog definitely is when she’s carrying it around everywhere 🥹 My only con is that I wish it came in other colors! I was surprised that she liked it so much because she typically prefers bright colored toys like red/orange/blue/green. It took some time, but once she warmed up to it and realized she could chew as hard as she wanted on it, it was game over from there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 11, 2025
M
Verified Purchase
Marty
Lake Worth, US
★★★★★ 4
Durable dog toy
Solid toy for Malinois
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026

recommand products